Homologs in group_1000

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05070 FBDBKF_05070 100.0 Morganella morganii S1 yciH stress response translation initiation inhibitor YciH
EHELCC_12520 EHELCC_12520 100.0 Morganella morganii S2 yciH stress response translation initiation inhibitor YciH
NLDBIP_12860 NLDBIP_12860 100.0 Morganella morganii S4 yciH stress response translation initiation inhibitor YciH
HKOGLL_11335 HKOGLL_11335 100.0 Morganella morganii S5 yciH stress response translation initiation inhibitor YciH
F4V73_RS05525 F4V73_RS05525 89.7 Morganella psychrotolerans yciH stress response translation initiation inhibitor YciH
PMI_RS06330 PMI_RS06330 81.3 Proteus mirabilis HI4320 yciH stress response translation initiation inhibitor YciH

Distribution of the homologs in the orthogroup group_1000

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1000

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P08245 3.84e-58 177 83 0 106 1 yciH Uncharacterized protein YciH Escherichia coli (strain K12)
P0A2G7 8.21e-56 171 78 0 106 3 yciH Uncharacterized protein YciH Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2G8 8.21e-56 171 78 0 106 3 yciH Uncharacterized protein YciH Salmonella typhi
P45116 9.87e-50 155 73 0 105 3 HI_1225 Uncharacterized protein HI_1225 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q55397 9.64e-16 70 39 2 105 3 sll0546 Uncharacterized protein sll0546 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A8AC05 2.94e-11 58 42 1 69 3 Igni_1281 Protein translation factor SUI1 homolog Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)
Q4JAE7 3.55e-11 58 37 1 82 3 Saci_0865 Protein translation factor SUI1 homolog Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
A2BIX0 4.48e-11 57 39 1 82 3 Hbut_0053 Protein translation factor SUI1 homolog Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5)
Q97BW9 8.34e-11 57 46 1 65 3 TV0336 Protein translation factor SUI1 homolog Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
Q6L1B9 2.61e-10 55 45 1 66 3 PTO0648 Protein translation factor SUI1 homolog Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
Q3IU96 2.81e-10 55 45 0 62 3 NP_0388A Protein translation factor SUI1 homolog Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q975S0 3.65e-10 55 36 1 82 3 STK_03500 Protein translation factor SUI1 homolog Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
O29348 4.59e-10 55 48 0 60 3 AF_0914 Protein translation factor SUI1 homolog Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q9YBG9 6.54e-10 54 40 1 82 3 APE_1629 Protein translation factor SUI1 homolog Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
P58193 6.89e-10 54 45 1 73 1 PH1771.1 Protein translation factor SUI1 homolog Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9V1U3 9.82e-10 54 46 1 69 3 PYRAB03340 Protein translation factor SUI1 homolog Pyrococcus abyssi (strain GE5 / Orsay)
Q8U006 1.04e-09 54 45 1 73 3 PF1817 Protein translation factor SUI1 homolog Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
A0B635 1.36e-09 53 44 1 70 3 Mthe_0366 Protein translation factor SUI1 homolog Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT)
Q9HME3 1.72e-09 53 43 0 62 3 VNG_2584C Protein translation factor SUI1 homolog Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R868 1.72e-09 53 43 0 62 3 OE_4626R Protein translation factor SUI1 homolog Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q5UZP9 1.72e-09 53 41 0 62 3 sui1 Protein translation factor SUI1 homolog Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q5JDH7 2.76e-09 53 46 0 65 3 TK1534 Protein translation factor SUI1 homolog Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
A3CX23 2.8e-09 53 41 1 72 3 Memar_1997 Protein translation factor SUI1 homolog Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
A4YIU6 3.21e-09 53 41 2 82 3 Msed_2210 Protein translation factor SUI1 homolog Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)
B8GDE2 5.05e-09 52 45 0 62 3 Mpal_1990 Protein translation factor SUI1 homolog Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
C5A278 1.18e-08 51 43 1 73 3 TGAM_1995 Protein translation factor SUI1 homolog Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)
O26118 2e-08 50 45 0 60 3 MTH_10 Protein translation factor SUI1 homolog Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q8PYK3 5.96e-08 49 36 1 69 3 MM_0858 Protein translation factor SUI1 homolog Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
A2SQ91 6.64e-08 49 38 1 72 3 Mlab_0321 Protein translation factor SUI1 homolog Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
Q8ZTB0 8.74e-08 49 39 2 79 3 PAE3340 Protein translation factor SUI1 homolog Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
Q46F27 9.66e-08 49 36 1 69 3 Mbar_A0534 Protein translation factor SUI1 homolog Methanosarcina barkeri (strain Fusaro / DSM 804)
Q8TIT3 9.66e-08 49 36 1 69 3 MA_4059 Protein translation factor SUI1 homolog Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
B6YSM1 1.08e-07 48 44 0 61 3 TON_0074 Protein translation factor SUI1 homolog Thermococcus onnurineus (strain NA1)
A7I9K6 1.18e-07 48 41 0 63 3 Mboo_1902 Protein translation factor SUI1 homolog Methanoregula boonei (strain DSM 21154 / JCM 14090 / 6A8)
Q2FTC8 2.88e-07 48 41 0 62 3 Mhun_2911 Protein translation factor SUI1 homolog Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q57902 3.96e-07 47 42 0 63 1 MJ0463 Protein translation factor SUI1 homolog Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q2NFW4 4.86e-07 47 41 0 60 3 Msp_0901 Protein translation factor SUI1 homolog Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Q12UF1 6.27e-07 47 34 1 69 3 Mbur_2049 Protein translation factor SUI1 homolog Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
Q8TX33 1.1e-06 46 42 1 61 3 MK0844 Protein translation factor SUI1 homolog Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
A9A389 1.35e-06 46 37 1 70 3 Nmar_0622 Protein translation factor SUI1 homolog Nitrosopumilus maritimus (strain SCM1)
A0RWW9 1.02e-05 43 35 1 70 3 CENSYa_1212 Protein translation factor SUI1 homolog Cenarchaeum symbiosum (strain A)
P14021 3.32e-05 42 39 0 63 3 None Protein translation factor SUI1 homolog Methanococcus vannielii
B9LR02 3.78e-05 42 43 0 62 3 Hlac_2078 Protein translation factor SUI1 homolog Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34)
Q6LXE5 0.000113 41 39 0 63 3 MMP1406 Protein translation factor SUI1 homolog Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
A6VGZ2 0.000113 41 39 0 63 3 MmarC7_0651 Protein translation factor SUI1 homolog Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
A9A9Q7 0.000113 41 39 0 63 3 MmarC6_1267 Protein translation factor SUI1 homolog Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
A4FWB4 0.000113 41 39 0 63 3 MmarC5_0172 Protein translation factor SUI1 homolog Methanococcus maripaludis (strain C5 / ATCC BAA-1333)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_12720
Feature type CDS
Gene yciH
Product stress response translation initiation inhibitor YciH
Location 161048 - 161371 (strand: 1)
Length 324 (nucleotides) / 107 (amino acids)
In genomic island -

Contig

Accession ZDB_369
Length 181491 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1000
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01253 Translation initiation factor SUI1

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0023 Translation, ribosomal structure and biogenesis (J) J Translation initiation factor 1 (eIF-1/SUI1)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03113 translation initiation factor 1 - -

Protein Sequence

MDNNSRLVYSTDAGRIDEPEVKAERPKGDGIVRIQRQTSGRKGKGVCLITGIDLDDAALSKLAADLKKRCGCGGALKDGVIEIQGDKRDLLKQLLEEKGFKVKLAGG

Flanking regions ( +/- flanking 50bp)

CCCGCAGGCGGCATTACAGGCGATTAATGCTTCAGTGGGAGTATTATAAGATGGACAATAATTCACGGCTGGTTTATTCCACCGATGCCGGCCGTATTGATGAGCCGGAAGTCAAAGCGGAACGCCCGAAAGGTGACGGTATTGTCCGTATTCAGCGTCAGACCAGCGGCCGCAAAGGTAAGGGTGTGTGCCTGATCACCGGTATTGATTTGGATGATGCTGCACTGAGCAAGCTGGCGGCAGATCTGAAAAAACGCTGCGGCTGCGGCGGGGCGCTGAAAGACGGTGTAATTGAAATTCAGGGTGATAAACGCGATTTACTGAAGCAACTGCTGGAAGAGAAAGGCTTCAAAGTCAAACTGGCAGGCGGCTGACAGAGAGATAAGGCGTCCATCCGGACGCCTTCATTACTGGCCGGCTTCGT