Homologs in group_991

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05490 FBDBKF_05490 100.0 Morganella morganii S1 hlx Putative hemolysin
EHELCC_12100 EHELCC_12100 100.0 Morganella morganii S2 hlx Putative hemolysin
NLDBIP_12440 NLDBIP_12440 100.0 Morganella morganii S4 hlx Putative hemolysin
HKOGLL_10915 HKOGLL_10915 100.0 Morganella morganii S5 hlx Putative hemolysin
F4V73_RS03805 F4V73_RS03805 65.3 Morganella psychrotolerans - DUF333 domain-containing protein
PMI_RS07335 PMI_RS07335 49.4 Proteus mirabilis HI4320 - DUF333 domain-containing protein

Distribution of the homologs in the orthogroup group_991

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_991

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ACW2 1.1e-09 53 38 2 85 3 ydbJ Uncharacterized protein YdbJ Escherichia coli (strain K12)
P0ACW3 1.1e-09 53 38 2 85 3 ydbJ Uncharacterized protein YdbJ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_12300
Feature type CDS
Gene hlx
Product Putative hemolysin
Location 72283 - 72588 (strand: 1)
Length 306 (nucleotides) / 101 (amino acids)

Contig

Accession ZDB_369
Length 181491 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_991
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03891 Domain of unknown function (DUF333)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3042 General function prediction only (R) R Putative hemolysin

Protein Sequence

MISVPFLRRPGRVLCSVIVAAAAFAAGCSSSPDTVQQKQIPRYQQPLIDLTEDARASCSYAGGTPSLIRELNGAQTPGCQFANGKRCSQQSLLSGSCGSVL

Flanking regions ( +/- flanking 50bp)

TCGAAAAGCAGTGTTCACTGAGCTGCATCCGCAGCTATGAGGCCATAATCATGATATCAGTTCCATTTCTCCGCCGTCCGGGGCGGGTATTGTGCAGTGTTATTGTTGCGGCAGCGGCTTTTGCTGCGGGTTGCAGCAGTTCACCGGATACGGTGCAGCAGAAACAGATCCCGCGCTATCAGCAACCGTTAATTGATTTAACCGAAGATGCCCGTGCCAGCTGCAGCTATGCAGGCGGAACGCCGTCACTTATCCGCGAGCTGAACGGCGCACAGACACCGGGGTGTCAGTTTGCCAACGGCAAACGCTGCAGTCAGCAGTCGCTGCTTTCCGGAAGTTGCGGATCGGTATTGTGAGAGATGCTCTGAACAGCCGCGTTATGATAACGCGGCTGTTATTGATTGGG