Homologs in group_1854

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13865 FBDBKF_13865 100.0 Morganella morganii S1 terZ Stress response protein SCP2
EHELCC_11535 EHELCC_11535 100.0 Morganella morganii S2 terZ Stress response protein SCP2
NLDBIP_11880 NLDBIP_11880 100.0 Morganella morganii S4 terZ Stress response protein SCP2
HKOGLL_10350 HKOGLL_10350 100.0 Morganella morganii S5 terZ Stress response protein SCP2
F4V73_RS12730 F4V73_RS12730 91.3 Morganella psychrotolerans - TerD family protein
PMI_RS11815 PMI_RS11815 72.0 Proteus mirabilis HI4320 - tellurium resistance-associated protein TerZ

Distribution of the homologs in the orthogroup group_1854

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1854

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q52353 3e-99 288 74 1 194 3 terZ Tellurium resistance protein TerZ Serratia marcescens
P81100 9.76e-46 152 42 5 198 1 yceC Stress response protein SCP2 Bacillus subtilis (strain 168)
P80875 5.07e-34 122 38 6 187 1 yceD General stress protein 16U Bacillus subtilis (strain 168)
Q45812 1.04e-32 119 41 7 187 3 None Chemical-damaging agent resistance protein C Clostridium acetobutylicum
O34384 1.69e-32 118 39 6 187 3 yceE Uncharacterized protein YceE Bacillus subtilis (strain 168)
Q52358 5.52e-30 112 38 6 188 3 terE Tellurium resistance protein TerE Serratia marcescens
Q52357 4.23e-29 109 38 6 187 3 terD Tellurium resistance protein TerD Serratia marcescens
P75012 1.92e-28 108 36 3 195 3 terX Tellurium resistance protein TerX Serratia marcescens
P18782 3.52e-28 107 36 6 188 3 terE Tellurium resistance protein TerE Alcaligenes sp.
P18781 4.25e-28 107 37 6 187 3 terD Tellurium resistance protein TerD Alcaligenes sp.
P19198 4.37e-24 99 34 6 190 2 capA-1 cAMP-binding protein 1 Dictyostelium discoideum
P34122 9.05e-24 98 35 7 190 1 capB cAMP-binding protein 2 Dictyostelium discoideum
Q45811 8.89e-15 71 42 3 121 3 None Chemical-damaging agent resistance protein B Clostridium acetobutylicum
P73042 2.71e-14 70 30 8 184 3 slr1764 Uncharacterized protein slr1764 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_11740
Feature type CDS
Gene terZ
Product Stress response protein SCP2
Location 152208 - 152795 (strand: -1)
Length 588 (nucleotides) / 195 (amino acids)

Contig

Accession ZDB_368
Length 188522 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1854
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02342 TerD domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2310 Signal transduction mechanisms (T) T Stress response protein SCP2

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05791 tellurium resistance protein TerZ - -

Protein Sequence

MVSLTKNQTVSLSKASAALNQLHFGLGWDPVQKKKGFLGSLFGGGNDSIDLDASCILLDKDGRILDTIWFRKLKSDCKSVIHEGDNLTGEGDGDDEVIRVDLNRLPQNTEYLAFTVNSFRGQTFNDVENAFCRVLDQSGKELVRYQLNEQGSHTGIVIASLCRSGGEWNFTAHGAACRGRTIDDMSSDIVSTVVL

Flanking regions ( +/- flanking 50bp)

ATCACCAGCACCTGTTGCCGGGTTTTATCTCCCGTTTAAGGAATGAAAATATGGTTTCATTGACGAAGAATCAGACGGTATCTCTCAGCAAGGCATCTGCCGCATTAAATCAGCTGCATTTCGGTCTCGGCTGGGATCCTGTTCAGAAAAAGAAAGGTTTTCTCGGTTCGCTGTTCGGCGGCGGTAACGACTCCATTGATCTGGATGCCAGCTGCATCCTGCTGGATAAAGACGGCCGTATTCTCGACACCATCTGGTTCCGCAAACTGAAATCAGACTGTAAATCCGTGATCCATGAAGGGGATAACCTGACCGGTGAGGGTGACGGAGATGATGAAGTGATCCGCGTGGACCTGAACCGTCTGCCGCAGAATACCGAATATCTGGCCTTTACGGTGAACAGCTTCCGTGGTCAGACATTTAACGATGTGGAAAATGCCTTCTGCCGTGTACTGGATCAGAGCGGTAAAGAGCTGGTGCGTTATCAGCTGAATGAACAGGGCTCACACACCGGTATCGTGATCGCCTCCCTGTGCCGCAGCGGCGGTGAGTGGAACTTTACCGCACACGGTGCTGCATGCCGCGGCCGCACGATTGACGACATGTCTTCCGACATTGTCAGTACGGTGGTGCTCTGATGAACATGACGCCCGGGGCGAATGCGCCCGTACCGCTGAAAACACTGCGG