Homologs in group_2921

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13790 FBDBKF_13790 100.0 Morganella morganii S1 glpR DNA-binding transcriptional regulator of sugar metabolism, DeoR/GlpR family
EHELCC_11460 EHELCC_11460 100.0 Morganella morganii S2 glpR DNA-binding transcriptional regulator of sugar metabolism, DeoR/GlpR family
NLDBIP_11805 NLDBIP_11805 100.0 Morganella morganii S4 glpR DNA-binding transcriptional regulator of sugar metabolism, DeoR/GlpR family
HKOGLL_10275 HKOGLL_10275 100.0 Morganella morganii S5 glpR DNA-binding transcriptional regulator of sugar metabolism, DeoR/GlpR family
F4V73_RS12660 F4V73_RS12660 88.4 Morganella psychrotolerans - DeoR/GlpR family DNA-binding transcription regulator

Distribution of the homologs in the orthogroup group_2921

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2921

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P94591 9.16e-35 128 34 2 222 1 glcR HTH-type transcriptional repressor GlcR Bacillus subtilis (strain 168)
P44780 6.21e-33 123 33 3 227 3 fucR L-fucose operon activator Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P52598 2.72e-29 114 28 3 233 4 ygbI Uncharacterized HTH-type transcriptional regulator YgbI Escherichia coli (strain K12)
P15082 3.72e-27 108 28 2 247 1 srlR Glucitol operon repressor Escherichia coli (strain K12)
P44978 4.89e-27 107 28 5 235 4 HI_1009 Uncharacterized HTH-type transcriptional regulator HI_1009 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q51391 1.67e-26 106 26 4 238 3 glpR Glycerol-3-phosphate regulon repressor Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O31713 3.78e-26 105 30 4 247 4 fruR Uncharacterized HTH-type transcriptional regulator FruR Bacillus subtilis (strain 168)
Q92ET8 4.48e-26 105 32 6 242 4 golR HTH-type transcriptional regulator GolR Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8CRJ1 7.32e-26 104 29 2 248 3 lacR Lactose phosphotransferase system repressor Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM34 7.32e-26 104 29 2 248 3 lacR Lactose phosphotransferase system repressor Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
O05261 9.92e-26 104 31 5 230 4 yulB Uncharacterized HTH-type transcriptional regulator YulB Bacillus subtilis (strain 168)
P18816 6.95e-25 102 30 4 243 4 lacR Lactose phosphotransferase system repressor Lactococcus lactis subsp. lactis
P0ACL1 5.28e-24 99 28 3 232 4 glpR Glycerol-3-phosphate regulon repressor Shigella flexneri
P0ACL0 5.28e-24 99 28 3 232 1 glpR Glycerol-3-phosphate regulon repressor Escherichia coli (strain K12)
P26422 2.58e-23 97 28 4 248 4 lacR Lactose phosphotransferase system repressor Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P32144 7.18e-23 97 27 5 253 1 csqR HTH-type transcriptional repressor CsqR Escherichia coli (strain K12)
P76034 1.16e-22 96 31 4 230 4 yciT Uncharacterized HTH-type transcriptional regulator YciT Escherichia coli (strain K12)
P0ACK2 2.52e-21 93 29 5 235 4 agaR Putative aga operon transcriptional repressor Escherichia coli (strain K12)
P0ACK3 2.52e-21 93 29 5 235 3 agaR Putative aga operon transcriptional repressor Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACK4 2.52e-21 93 29 5 235 3 agaR Putative aga operon transcriptional repressor Escherichia coli O157:H7
P67744 3.83e-21 92 27 3 251 1 lacR Lactose phosphotransferase system repressor Staphylococcus aureus (strain N315)
P67743 3.83e-21 92 27 3 251 3 lacR Lactose phosphotransferase system repressor Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q6GEN3 4.48e-21 92 27 3 251 3 lacR Lactose phosphotransferase system repressor Staphylococcus aureus (strain MRSA252)
P0ACK9 7.87e-21 91 27 3 231 3 fucR L-fucose operon activator Shigella flexneri
P0ACK8 7.87e-21 91 27 3 231 4 fucR L-fucose operon activator Escherichia coli (strain K12)
P0A0P9 1.77e-20 90 26 3 251 3 lacR Lactose phosphotransferase system repressor Staphylococcus aureus (strain MW2)
Q6G7B8 1.77e-20 90 26 3 251 3 lacR Lactose phosphotransferase system repressor Staphylococcus aureus (strain MSSA476)
Q5HE08 1.77e-20 90 26 3 251 3 lacR Lactose phosphotransferase system repressor Staphylococcus aureus (strain COL)
P0A0Q0 1.77e-20 90 26 3 251 4 lacR Lactose phosphotransferase system repressor Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q8CSL5 4.07e-20 89 32 4 237 4 SE_1102 Uncharacterized HTH-type transcriptional regulator SE_1102 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P46337 8.13e-20 88 32 5 225 4 iolR HTH-type transcriptional regulator IolR Bacillus subtilis (strain 168)
P44784 2.02e-19 87 27 4 246 3 glpR Glycerol-3-phosphate regulon repressor Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
D4GYE7 3.56e-19 87 28 4 233 2 glpR HTH-type transcriptional regulator GlpR Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
P32104 1.17e-17 82 27 6 249 4 accR Transcriptional repressor AccR Agrobacterium fabrum (strain C58 / ATCC 33970)
P77721 2.38e-16 79 30 6 229 1 ydjF Uncharacterized HTH-type transcriptional regulator YdjF Escherichia coli (strain K12)
Q328K6 2.51e-16 79 24 4 231 3 ulaR HTH-type transcriptional regulator UlaR Shigella dysenteriae serotype 1 (strain Sd197)
B7UQK0 3.92e-16 78 24 4 231 3 ulaR HTH-type transcriptional regulator UlaR Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q3YUF6 4.17e-16 78 24 4 231 3 ulaR HTH-type transcriptional regulator UlaR Shigella sonnei (strain Ss046)
Q31TC2 4.26e-16 78 24 4 231 3 ulaR HTH-type transcriptional regulator UlaR Shigella boydii serotype 4 (strain Sb227)
B2TY64 4.26e-16 78 24 4 231 3 ulaR HTH-type transcriptional regulator UlaR Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R369 4.26e-16 78 24 4 231 3 ulaR HTH-type transcriptional regulator UlaR Escherichia coli (strain UTI89 / UPEC)
B6I296 4.26e-16 78 24 4 231 3 ulaR HTH-type transcriptional regulator UlaR Escherichia coli (strain SE11)
B7NGC5 4.26e-16 78 24 4 231 3 ulaR HTH-type transcriptional regulator UlaR Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A9W0 4.26e-16 78 24 4 231 1 ulaR HTH-type transcriptional regulator UlaR Escherichia coli (strain K12)
B1IT15 4.26e-16 78 24 4 231 3 ulaR HTH-type transcriptional regulator UlaR Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A9W1 4.26e-16 78 24 4 231 3 ulaR HTH-type transcriptional regulator UlaR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0T9K2 4.26e-16 78 24 4 231 3 ulaR HTH-type transcriptional regulator UlaR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AJ96 4.26e-16 78 24 4 231 3 ulaR HTH-type transcriptional regulator UlaR Escherichia coli O1:K1 / APEC
A8A7T7 4.26e-16 78 24 4 231 3 ulaR HTH-type transcriptional regulator UlaR Escherichia coli O9:H4 (strain HS)
B1XDU2 4.26e-16 78 24 4 231 3 ulaR HTH-type transcriptional regulator UlaR Escherichia coli (strain K12 / DH10B)
C4ZR68 4.26e-16 78 24 4 231 3 ulaR HTH-type transcriptional regulator UlaR Escherichia coli (strain K12 / MC4100 / BW2952)
B7M8V1 4.26e-16 78 24 4 231 3 ulaR HTH-type transcriptional regulator UlaR Escherichia coli O8 (strain IAI1)
B7MSL0 4.26e-16 78 24 4 231 3 ulaR HTH-type transcriptional regulator UlaR Escherichia coli O81 (strain ED1a)
B5Z2J7 4.26e-16 78 24 4 231 3 ulaR HTH-type transcriptional regulator UlaR Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A9W2 4.26e-16 78 24 4 231 3 ulaR HTH-type transcriptional regulator UlaR Escherichia coli O157:H7
B7LC45 4.26e-16 78 24 4 231 3 ulaR HTH-type transcriptional regulator UlaR Escherichia coli (strain 55989 / EAEC)
B7MLJ6 4.26e-16 78 24 4 231 3 ulaR HTH-type transcriptional regulator UlaR Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZV62 4.26e-16 78 24 4 231 3 ulaR HTH-type transcriptional regulator UlaR Escherichia coli O139:H28 (strain E24377A / ETEC)
B1LQL1 5.16e-16 78 24 4 231 3 ulaR HTH-type transcriptional regulator UlaR Escherichia coli (strain SMS-3-5 / SECEC)
B7NTP7 5.16e-16 78 24 4 231 3 ulaR HTH-type transcriptional regulator UlaR Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A9MFM3 5.21e-16 78 24 4 231 3 ulaR HTH-type transcriptional regulator UlaR Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q83P30 1.32e-15 77 24 4 231 3 ulaR HTH-type transcriptional regulator UlaR Shigella flexneri
Q0SX94 1.32e-15 77 24 4 231 3 ulaR HTH-type transcriptional regulator UlaR Shigella flexneri serotype 5b (strain 8401)
Q7CP93 3.47e-15 75 25 4 216 3 ulaR HTH-type transcriptional regulator UlaR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XG96 3.47e-15 75 25 4 216 3 ulaR HTH-type transcriptional regulator UlaR Salmonella typhi
B4TSH1 3.47e-15 75 25 4 216 3 ulaR HTH-type transcriptional regulator UlaR Salmonella schwarzengrund (strain CVM19633)
B5BKJ9 3.47e-15 75 25 4 216 3 ulaR HTH-type transcriptional regulator UlaR Salmonella paratyphi A (strain AKU_12601)
C0Q6E8 3.47e-15 75 25 4 216 3 ulaR HTH-type transcriptional regulator UlaR Salmonella paratyphi C (strain RKS4594)
A9N507 3.47e-15 75 25 4 216 3 ulaR HTH-type transcriptional regulator UlaR Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PJ50 3.47e-15 75 25 4 216 3 ulaR HTH-type transcriptional regulator UlaR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T3E2 3.47e-15 75 25 4 216 3 ulaR HTH-type transcriptional regulator UlaR Salmonella newport (strain SL254)
B4TFC5 3.47e-15 75 25 4 216 3 ulaR HTH-type transcriptional regulator UlaR Salmonella heidelberg (strain SL476)
B5R0Q8 3.47e-15 75 25 4 216 3 ulaR HTH-type transcriptional regulator UlaR Salmonella enteritidis PT4 (strain P125109)
B5FS93 3.47e-15 75 25 4 216 3 ulaR HTH-type transcriptional regulator UlaR Salmonella dublin (strain CT_02021853)
Q57GK1 3.47e-15 75 25 4 216 3 ulaR HTH-type transcriptional regulator UlaR Salmonella choleraesuis (strain SC-B67)
B5F3A7 3.47e-15 75 25 4 216 3 ulaR HTH-type transcriptional regulator UlaR Salmonella agona (strain SL483)
P36930 2.24e-12 65 38 1 97 5 gatR Putative galactitol utilization operon repressor Escherichia coli (strain K12)
P0ACK5 2.05e-09 59 25 8 230 1 deoR Deoxyribose operon repressor Escherichia coli (strain K12)
P0ACK6 2.05e-09 59 25 8 230 3 deoR Deoxyribose operon repressor Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACK7 2.05e-09 59 25 8 230 3 deoR Deoxyribose operon repressor Escherichia coli O157:H7
P39361 8.46e-09 58 24 4 229 4 sgcR Putative sgc region transcriptional regulator Escherichia coli (strain K12)
P94433 0.001 42 32 0 55 1 ycnK HTH-type transcriptional repressor YcnK Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_11665
Feature type CDS
Gene glpR
Product DNA-binding transcriptional regulator of sugar metabolism, DeoR/GlpR family
Location 136741 - 137496 (strand: 1)
Length 756 (nucleotides) / 251 (amino acids)

Contig

Accession ZDB_368
Length 188522 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2921
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00455 DeoR C terminal sensor domain
PF08220 DeoR-like helix-turn-helix domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1349 Transcription (K)
Carbohydrate transport and metabolism (G)		 KG DNA-binding transcriptional regulator of sugar metabolism, DeoR/GlpR family

Protein Sequence

MNPIKRKEYILDLLNQQGEVSVQDLADTLNVTSETIRRDLSILEKEGEIIKIHGGAMKKKSVSEGSFEQRLELNREEKMTLARYAAGLISEHDTLYIDSCSTTLLFSAQLPAIAFTVFTNSALIADKIASQNPLAKVYVLGGEYNHEFRANLGAKTLHEIDHIYADFAFVGAGGVRDEGILVKSVEEGMIARKMLEKSKQKIILADSSKFGQQGILKIAEIAVIDKIICDDKWQKAHEFREKYPEKVVIVP

Flanking regions ( +/- flanking 50bp)

CACATAATGCGCTAATATTGTTCATGTTTACGAGTGTGATGAGAACGGTCATGAATCCGATAAAAAGAAAGGAATACATCCTCGATCTGCTGAATCAGCAGGGGGAAGTCAGTGTGCAGGATCTTGCTGATACACTGAATGTCACCTCTGAGACGATCCGCCGTGATCTCTCCATTCTGGAGAAAGAAGGCGAGATCATCAAAATTCACGGCGGGGCGATGAAGAAAAAGAGTGTCAGCGAAGGCAGCTTTGAACAGCGGCTGGAACTGAACCGCGAGGAAAAAATGACCCTCGCGCGCTATGCTGCCGGGCTGATTTCCGAGCACGACACACTGTATATCGATTCCTGTTCGACAACGCTGCTGTTTTCCGCGCAGTTACCGGCAATTGCATTTACCGTTTTCACCAATTCTGCCCTTATTGCGGATAAAATTGCCTCACAAAACCCGCTGGCAAAAGTGTATGTGCTGGGTGGTGAATACAACCATGAATTCCGGGCCAATCTCGGTGCGAAAACCCTGCATGAAATTGATCATATTTATGCGGACTTCGCCTTTGTCGGCGCAGGCGGTGTGCGTGATGAAGGTATTCTGGTCAAAAGCGTTGAAGAAGGCATGATTGCGCGGAAAATGCTGGAAAAAAGTAAGCAGAAAATTATTCTGGCCGACTCCAGCAAATTCGGCCAGCAGGGGATTTTAAAGATCGCGGAGATTGCCGTTATCGATAAAATTATCTGTGACGATAAATGGCAGAAAGCACACGAATTCCGTGAAAAATATCCGGAAAAAGTCGTTATCGTGCCATAAGGGAAAAAACCTTACAGCTGTGACGGCTCGCTGTGATGGCCGGTCATCCG