Homologs in group_2046

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15340 FBDBKF_15340 100.0 Morganella morganii S1 epmA elongation factor P--(R)-beta-lysine ligase
EHELCC_10905 EHELCC_10905 100.0 Morganella morganii S2 epmA elongation factor P--(R)-beta-lysine ligase
NLDBIP_11250 NLDBIP_11250 100.0 Morganella morganii S4 epmA elongation factor P--(R)-beta-lysine ligase
HKOGLL_09720 HKOGLL_09720 100.0 Morganella morganii S5 epmA elongation factor P--(R)-beta-lysine ligase
F4V73_RS12115 F4V73_RS12115 96.3 Morganella psychrotolerans epmA elongation factor P--(R)-beta-lysine ligase
PMI_RS17855 PMI_RS17855 84.9 Proteus mirabilis HI4320 epmA elongation factor P--(R)-beta-lysine ligase

Distribution of the homologs in the orthogroup group_2046

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2046

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EWY8 0.0 583 84 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Proteus mirabilis (strain HI4320)
A8G8T8 0.0 572 81 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Serratia proteamaculans (strain 568)
Q7MZY6 0.0 571 82 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C5BDL9 0.0 570 80 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Edwardsiella ictaluri (strain 93-146)
B1JMQ1 0.0 568 81 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FC6 0.0 568 81 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TRQ1 0.0 568 81 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Yersinia pestis (strain Pestoides F)
Q1CEE4 0.0 568 81 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Yersinia pestis bv. Antiqua (strain Nepal516)
A9QYP2 0.0 568 81 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZIX3 0.0 568 81 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Yersinia pestis
B2K1Z3 0.0 568 81 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C0Y9 0.0 568 81 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FMZ1 0.0 568 81 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A9MFQ6 0.0 553 79 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8Z197 0.0 551 79 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Salmonella typhi
B5FRL4 0.0 550 79 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Salmonella dublin (strain CT_02021853)
Q9ZJ12 0.0 549 79 0 325 1 epmA Elongation factor P--(R)-beta-lysine ligase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TF92 0.0 549 79 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Salmonella heidelberg (strain SL476)
B5R019 0.0 549 79 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Salmonella enteritidis PT4 (strain P125109)
B5F2M2 0.0 549 79 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Salmonella agona (strain SL483)
A1JIQ4 0.0 549 78 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B5BKG8 0.0 548 78 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Salmonella paratyphi A (strain AKU_12601)
Q5PLH2 0.0 548 78 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TSD9 0.0 548 78 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Salmonella schwarzengrund (strain CVM19633)
C0Q6B6 0.0 548 78 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Salmonella paratyphi C (strain RKS4594)
A9N413 0.0 548 78 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T2Q3 0.0 548 78 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Salmonella newport (strain SL254)
Q57GN3 0.0 548 78 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Salmonella choleraesuis (strain SC-B67)
B5Y345 0.0 546 78 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Klebsiella pneumoniae (strain 342)
P0A8P0 0.0 545 77 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Shigella flexneri
Q0SXC1 0.0 545 77 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Shigella flexneri serotype 5b (strain 8401)
B2TY33 0.0 545 77 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R3A2 0.0 545 77 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Escherichia coli (strain UTI89 / UPEC)
B1LQH8 0.0 545 77 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Escherichia coli (strain SMS-3-5 / SECEC)
B6I264 0.0 545 77 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Escherichia coli (strain SE11)
B7NG94 0.0 545 77 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8N7 0.0 545 77 0 325 1 epmA Elongation factor P--(R)-beta-lysine ligase Escherichia coli (strain K12)
P0A8N8 0.0 545 77 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0T9N4 0.0 545 77 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A7Q4 0.0 545 77 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Escherichia coli O9:H4 (strain HS)
B1XDQ9 0.0 545 77 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Escherichia coli (strain K12 / DH10B)
C5A1E9 0.0 545 77 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M8S0 0.0 545 77 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Escherichia coli O8 (strain IAI1)
B7MSX2 0.0 545 77 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Escherichia coli O81 (strain ED1a)
B7NTL6 0.0 545 77 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z2G6 0.0 545 77 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8N9 0.0 545 77 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Escherichia coli O157:H7
B7LC16 0.0 545 77 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Escherichia coli (strain 55989 / EAEC)
B7MKW2 0.0 545 77 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UPX7 0.0 545 77 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZV28 0.0 545 77 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Escherichia coli O139:H28 (strain E24377A / ETEC)
A6TH74 0.0 544 78 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B1ITP1 0.0 544 77 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8AMP1 0.0 543 77 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5R9A5 0.0 541 78 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B7LLT9 0.0 540 77 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A4W5Q2 0.0 537 76 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Enterobacter sp. (strain 638)
C6DFN3 0.0 534 76 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D033 0.0 531 76 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B2VCV6 0.0 530 77 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q2NW90 0.0 519 74 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Sodalis glossinidius (strain morsitans)
C4K3U1 0.0 515 71 0 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q65S20 8.16e-152 431 64 1 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q7VPM9 1.02e-151 431 63 2 329 3 epmA Elongation factor P--(R)-beta-lysine ligase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q6LM16 2.01e-150 428 63 0 319 3 epmA Elongation factor P--(R)-beta-lysine ligase Photobacterium profundum (strain SS9)
P57824 1.96e-149 426 62 2 326 3 epmA Elongation factor P--(R)-beta-lysine ligase Pasteurella multocida (strain Pm70)
Q9KNS6 8.89e-149 424 63 0 319 3 epmA Elongation factor P--(R)-beta-lysine ligase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9ZIY0 1.84e-148 423 63 1 319 3 epmA Elongation factor P--(R)-beta-lysine ligase Avibacterium paragallinarum
A5UHY5 2.08e-148 423 62 1 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Haemophilus influenzae (strain PittGG)
A6VQ84 3.48e-148 422 63 1 319 3 epmA Elongation factor P--(R)-beta-lysine ligase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A5UDN8 6.79e-148 422 62 1 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Haemophilus influenzae (strain PittEE)
B0USM2 1.58e-147 421 63 1 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Histophilus somni (strain 2336)
Q0I4V7 1.58e-147 421 63 1 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Histophilus somni (strain 129Pt)
P43826 8.4e-147 419 62 1 325 3 epmA Elongation factor P--(R)-beta-lysine ligase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7MGX9 2.92e-146 417 62 0 317 3 epmA Elongation factor P--(R)-beta-lysine ligase Vibrio vulnificus (strain YJ016)
Q8DCX0 2.92e-146 417 62 0 317 3 epmA Elongation factor P--(R)-beta-lysine ligase Vibrio vulnificus (strain CMCP6)
Q87KY6 6.64e-146 416 61 0 315 3 epmA Elongation factor P--(R)-beta-lysine ligase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B7VHR8 4.86e-145 414 62 0 319 3 epmA Elongation factor P--(R)-beta-lysine ligase Vibrio atlanticus (strain LGP32)
A7MX66 6.89e-143 409 60 0 315 3 epmA Elongation factor P--(R)-beta-lysine ligase Vibrio campbellii (strain ATCC BAA-1116)
Q3IFP4 1.53e-135 390 57 0 319 3 epmA Elongation factor P--(R)-beta-lysine ligase Pseudoalteromonas translucida (strain TAC 125)
B8D8A2 1.79e-130 377 52 0 319 3 epmA Elongation factor P--(R)-beta-lysine ligase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
B8D8E5 1.79e-130 377 52 0 319 3 epmA Elongation factor P--(R)-beta-lysine ligase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
P57642 3.09e-130 377 52 0 319 3 epmA Elongation factor P--(R)-beta-lysine ligase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q1LSP8 2.23e-128 372 57 1 327 3 epmA Elongation factor P--(R)-beta-lysine ligase Baumannia cicadellinicola subsp. Homalodisca coagulata
Q9Z614 6.24e-124 361 49 1 320 5 epmA Elongation factor P--(R)-beta-lysine ligase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q89A27 2.12e-104 311 45 2 320 3 epmA Elongation factor P--(R)-beta-lysine ligase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
O66963 7.72e-52 176 36 7 293 3 genX Elongation factor P--(R)-beta-lysine ligase homolog Aquifex aeolicus (strain VF5)
Q2RM49 1.32e-50 177 36 8 332 3 lysS Lysine--tRNA ligase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q8TSN5 3.04e-50 177 34 7 322 3 lysS2 Lysine--tRNA ligase 2 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8PVP6 2.02e-48 172 35 8 322 3 lysS2 Lysine--tRNA ligase 2 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q88Z28 2.1e-48 172 33 6 325 3 lysS Lysine--tRNA ligase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q7NG18 3.64e-48 171 34 7 326 3 lysS Lysine--tRNA ligase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q2IPX5 8.09e-48 171 34 8 341 3 lysS Lysine--tRNA ligase Anaeromyxobacter dehalogenans (strain 2CP-C)
Q3ARD7 9.23e-48 171 34 6 323 3 lysS Lysine--tRNA ligase Chlorobium chlorochromatii (strain CaD3)
B4UGU5 2.9e-47 169 34 7 337 3 lysS Lysine--tRNA ligase Anaeromyxobacter sp. (strain K)
B8JFW2 2.9e-47 169 34 7 337 3 lysS Lysine--tRNA ligase Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
B2GA78 2.33e-46 166 33 6 323 3 lysS Lysine--tRNA ligase Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
A8FKI8 2.37e-46 166 34 8 329 3 lysS Lysine--tRNA ligase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q0B0N3 3.4e-46 166 33 5 324 3 lysS Lysine--tRNA ligase Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
B3QMN9 5.27e-46 166 33 6 324 3 lysS Lysine--tRNA ligase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
A1VYC1 9.93e-46 165 34 8 329 3 lysS Lysine--tRNA ligase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
P41258 9.93e-46 165 34 8 329 3 lysS Lysine--tRNA ligase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q8KCM7 1.13e-45 165 33 6 325 3 lysS Lysine--tRNA ligase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q5HW66 1.29e-45 164 34 8 329 3 lysS Lysine--tRNA ligase Campylobacter jejuni (strain RM1221)
P41255 1.37e-45 164 35 8 325 1 lysS Lysine--tRNA ligase Thermus thermophilus
Q5SJG7 1.37e-45 164 35 8 325 3 lysS Lysine--tRNA ligase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72JT9 1.37e-45 164 35 8 325 3 lysS Lysine--tRNA ligase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
A7H4X7 1.57e-45 164 34 8 329 3 lysS Lysine--tRNA ligase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q53638 1.82e-45 164 34 6 326 1 lysS Lysine--tRNA ligase Staphylococcus aureus
Q8DMA9 2.85e-45 164 33 8 327 3 lysS Lysine--tRNA ligase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
P47382 4.38e-45 163 31 5 324 3 lysS Lysine--tRNA ligase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q49V26 4.48e-45 163 32 6 326 3 lysS Lysine--tRNA ligase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q6GJF4 6.37e-45 162 33 6 326 3 lysS Lysine--tRNA ligase Staphylococcus aureus (strain MRSA252)
A3CY14 6.75e-45 163 33 6 320 3 lysS Lysine--tRNA ligase Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
A0L6F7 7.25e-45 162 33 7 322 3 lysS Lysine--tRNA ligase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A7I3S8 8.2e-45 162 35 9 321 3 lysS Lysine--tRNA ligase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
A5D5Q4 8.46e-45 162 33 7 325 3 lysS Lysine--tRNA ligase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
P67610 8.78e-45 162 33 6 326 1 lysS Lysine--tRNA ligase Staphylococcus aureus (strain N315)
P67609 8.78e-45 162 33 6 326 3 lysS Lysine--tRNA ligase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HIF7 8.78e-45 162 33 6 326 3 lysS Lysine--tRNA ligase Staphylococcus aureus (strain COL)
Q2YVW8 8.78e-45 162 33 6 326 3 lysS Lysine--tRNA ligase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G0Q3 8.78e-45 162 33 6 326 3 lysS Lysine--tRNA ligase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJC3 8.78e-45 162 33 6 326 3 lysS Lysine--tRNA ligase Staphylococcus aureus (strain USA300)
A7WYS8 8.78e-45 162 33 6 326 3 lysS Lysine--tRNA ligase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q7VRF5 9.22e-45 162 31 7 330 3 lysS Lysine--tRNA ligase Blochmanniella floridana
Q5QYV9 1.16e-44 162 34 7 329 3 lysS Lysine--tRNA ligase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A1T047 1.37e-44 162 33 6 325 3 lysS Lysine--tRNA ligase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q8NXZ0 1.37e-44 162 33 6 326 3 lysS Lysine--tRNA ligase Staphylococcus aureus (strain MW2)
Q6GBX1 1.37e-44 162 33 6 326 3 lysS Lysine--tRNA ligase Staphylococcus aureus (strain MSSA476)
Q839A8 1.63e-44 161 32 6 325 3 lysS Lysine--tRNA ligase Enterococcus faecalis (strain ATCC 700802 / V583)
Q9RXE1 1.79e-44 162 37 9 326 3 lysS Lysine--tRNA ligase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A8G7C4 2.54e-44 161 34 10 330 3 lysS Lysine--tRNA ligase Prochlorococcus marinus (strain MIT 9215)
A0KNK7 2.55e-44 161 34 8 334 3 lysS Lysine--tRNA ligase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q3B365 4.25e-44 160 33 5 323 3 lysS Lysine--tRNA ligase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
A2BZ03 4.34e-44 160 30 6 323 3 lysS Lysine--tRNA ligase Prochlorococcus marinus (strain MIT 9515)
A3PFA8 6.55e-44 160 34 10 330 3 lysS Lysine--tRNA ligase Prochlorococcus marinus (strain MIT 9301)
O67258 7.01e-44 161 33 9 323 3 lysS Lysine--tRNA ligase Aquifex aeolicus (strain VF5)
B4SB22 1.08e-43 159 33 7 324 3 lysS Lysine--tRNA ligase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
P57822 1.11e-43 159 33 7 324 3 lysS Lysine--tRNA ligase Pasteurella multocida (strain Pm70)
Q81J70 1.12e-43 159 33 9 329 3 lysS Lysine--tRNA ligase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HJ16 1.12e-43 159 33 9 329 3 lysS Lysine--tRNA ligase Bacillus cereus (strain B4264)
Q8CQV5 1.46e-43 159 33 9 332 3 lysS Lysine--tRNA ligase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRN7 1.46e-43 159 33 9 332 3 lysS Lysine--tRNA ligase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A4SJK0 1.74e-43 159 33 8 334 3 lysS Lysine--tRNA ligase Aeromonas salmonicida (strain A449)
B4F0M6 1.8e-43 159 31 7 332 3 lysS Lysine--tRNA ligase Proteus mirabilis (strain HI4320)
B0KCE4 1.84e-43 159 32 8 326 3 lysS Lysine--tRNA ligase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q03E09 2.6e-43 158 33 7 324 3 lysS Lysine--tRNA ligase Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
B8GRJ2 2.64e-43 158 34 7 322 3 lysS Lysine--tRNA ligase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q6D945 2.68e-43 158 32 8 326 3 lysS Lysine--tRNA ligase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7UZP0 3.3e-43 158 32 9 331 3 lysS Lysine--tRNA ligase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
A5UCQ0 3.44e-43 158 33 7 327 3 lysS Lysine--tRNA ligase Haemophilus influenzae (strain PittEE)
Q38V83 3.61e-43 158 34 9 327 3 lysS Lysine--tRNA ligase Latilactobacillus sakei subsp. sakei (strain 23K)
Q7U9X5 3.7e-43 158 33 9 328 3 lysS Lysine--tRNA ligase Parasynechococcus marenigrum (strain WH8102)
Q83E97 4.18e-43 158 31 5 324 3 lysS Lysine--tRNA ligase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NBP7 4.18e-43 158 31 5 324 3 lysS Lysine--tRNA ligase Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KEG1 4.18e-43 158 31 5 324 3 lysS Lysine--tRNA ligase Coxiella burnetii (strain Dugway 5J108-111)
B6J1P6 4.18e-43 158 31 5 324 3 lysS Lysine--tRNA ligase Coxiella burnetii (strain CbuG_Q212)
B6J8K2 4.18e-43 158 31 5 324 3 lysS Lysine--tRNA ligase Coxiella burnetii (strain CbuK_Q154)
A5FRN5 4.32e-43 158 31 7 324 3 lysS Lysine--tRNA ligase Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
Q4L3H5 4.4e-43 157 33 6 326 3 lysS Lysine--tRNA ligase Staphylococcus haemolyticus (strain JCSC1435)
Q3ZWX9 4.59e-43 157 31 7 324 3 lysS Lysine--tRNA ligase Dehalococcoides mccartyi (strain CBDB1)
Q3Z8X9 4.88e-43 157 32 7 328 3 lysS Lysine--tRNA ligase Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q6HPU0 5.17e-43 157 34 9 329 3 lysS Lysine--tRNA ligase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63HC2 5.17e-43 157 34 9 329 3 lysS Lysine--tRNA ligase Bacillus cereus (strain ZK / E33L)
Q81VW3 5.17e-43 157 34 9 329 3 lysS Lysine--tRNA ligase Bacillus anthracis
A0R8E9 5.17e-43 157 34 9 329 3 lysS Lysine--tRNA ligase Bacillus thuringiensis (strain Al Hakam)
P43825 5.25e-43 157 33 7 327 3 lysS Lysine--tRNA ligase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q2FSN8 5.5e-43 157 31 7 322 3 lysS Lysine--tRNA ligase Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
B7JK84 5.67e-43 157 34 9 329 3 lysS Lysine--tRNA ligase Bacillus cereus (strain AH820)
A5CWL4 6.79e-43 157 32 7 324 3 lysS Lysine--tRNA ligase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
B7HPY8 6.9e-43 157 34 9 329 3 lysS Lysine--tRNA ligase Bacillus cereus (strain AH187)
Q73FD1 6.9e-43 157 34 9 329 3 lysS Lysine--tRNA ligase Bacillus cereus (strain ATCC 10987 / NRS 248)
B0URW9 6.94e-43 157 33 7 324 3 lysS Lysine--tRNA ligase Histophilus somni (strain 2336)
B7ISY7 8.48e-43 157 33 9 329 3 lysS Lysine--tRNA ligase Bacillus cereus (strain G9842)
Q5N1D9 9.36e-43 157 33 8 327 3 lysS Lysine--tRNA ligase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31KH4 9.36e-43 157 33 8 327 3 lysS Lysine--tRNA ligase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q8D2B3 9.39e-43 157 30 6 325 3 lysS Lysine--tRNA ligase Wigglesworthia glossinidia brevipalpis
Q5E7P8 9.5e-43 157 32 6 332 3 lysS Lysine--tRNA ligase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q8R7N1 1.08e-42 157 32 7 324 3 lysS Lysine--tRNA ligase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
P56126 1.17e-42 157 33 7 329 3 lysS Lysine--tRNA ligase Helicobacter pylori (strain ATCC 700392 / 26695)
B6JPT1 1.36e-42 156 33 7 329 3 lysS Lysine--tRNA ligase Helicobacter pylori (strain P12)
A9WK04 1.48e-42 156 31 7 322 3 lysS Lysine--tRNA ligase Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
B0K5C0 1.64e-42 156 32 8 326 3 lysS Lysine--tRNA ligase Thermoanaerobacter sp. (strain X514)
Q82SH1 1.74e-42 156 33 7 322 3 lysS Lysine--tRNA ligase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q72R38 1.95e-42 156 32 7 330 3 lysS Lysine--tRNA ligase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q8F4P5 1.99e-42 156 32 7 330 3 lysS Lysine--tRNA ligase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q47WT5 2.02e-42 156 31 6 342 3 lysS Lysine--tRNA ligase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q65SB0 2.26e-42 156 32 7 324 3 lysS Lysine--tRNA ligase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B2US13 2.66e-42 155 34 7 323 3 lysS Lysine--tRNA ligase Helicobacter pylori (strain Shi470)
A7GJY9 2.69e-42 155 33 9 329 3 lysS Lysine--tRNA ligase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B8CU98 2.88e-42 155 34 8 333 3 lysS Lysine--tRNA ligase Shewanella piezotolerans (strain WP3 / JCM 13877)
Q1CUX6 3.14e-42 155 33 7 329 3 lysS Lysine--tRNA ligase Helicobacter pylori (strain HPAG1)
C6D8Z6 3.17e-42 155 32 7 324 3 lysS Lysine--tRNA ligase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q4QL88 3.22e-42 155 33 7 327 3 lysS Lysine--tRNA ligase Haemophilus influenzae (strain 86-028NP)
A5UIX4 3.39e-42 155 33 7 327 3 lysS Lysine--tRNA ligase Haemophilus influenzae (strain PittGG)
B1KFR7 3.48e-42 155 33 8 335 3 lysS Lysine--tRNA ligase Shewanella woodyi (strain ATCC 51908 / MS32)
Q3ANE6 3.64e-42 155 33 9 328 3 lysS Lysine--tRNA ligase Synechococcus sp. (strain CC9605)
A8H0J7 3.98e-42 155 33 8 335 3 lysS Lysine--tRNA ligase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A9VN90 4.15e-42 155 33 9 329 3 lysS Lysine--tRNA ligase Bacillus mycoides (strain KBAB4)
P37477 4.28e-42 155 33 8 325 3 lysS Lysine--tRNA ligase Bacillus subtilis (strain 168)
B5Z9V6 4.36e-42 155 33 7 332 3 lysS Lysine--tRNA ligase Helicobacter pylori (strain G27)
Q8YAB8 4.67e-42 155 32 6 325 3 lysS Lysine--tRNA ligase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q3A9M2 5.22e-42 155 32 6 323 3 lysS Lysine--tRNA ligase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q9RHV9 5.23e-42 155 33 7 329 1 lysS Lysine--tRNA ligase Geobacillus stearothermophilus
B5F9U5 5.36e-42 155 32 6 332 3 lysS Lysine--tRNA ligase Aliivibrio fischeri (strain MJ11)
B6EMX2 5.64e-42 155 32 7 332 3 lysS Lysine--tRNA ligase Aliivibrio salmonicida (strain LFI1238)
Q724I4 6.36e-42 154 32 7 326 3 lysS Lysine--tRNA ligase Listeria monocytogenes serotype 4b (strain F2365)
Q1QT66 6.48e-42 155 33 7 325 3 lysS Lysine--tRNA ligase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q3SKD9 6.59e-42 154 32 6 324 3 lysS Lysine--tRNA ligase Thiobacillus denitrificans (strain ATCC 25259)
B2VF45 6.61e-42 155 32 4 323 3 lysS Lysine--tRNA ligase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q17YS1 6.72e-42 154 33 7 329 3 lysS Lysine--tRNA ligase Helicobacter acinonychis (strain Sheeba)
Q92F47 7.89e-42 154 33 7 326 3 lysS Lysine--tRNA ligase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P73443 8.43e-42 154 32 8 327 3 lysS Lysine--tRNA ligase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q0IDW9 8.52e-42 154 33 9 328 3 lysS Lysine--tRNA ligase Synechococcus sp. (strain CC9311)
A8FRH9 8.92e-42 154 33 7 331 3 lysS Lysine--tRNA ligase Shewanella sediminis (strain HAW-EB3)
A5GQ58 9.39e-42 154 33 5 322 3 lysS Lysine--tRNA ligase Synechococcus sp. (strain RCC307)
A6VPH6 9.63e-42 154 32 6 322 3 lysS Lysine--tRNA ligase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q7VLU5 1.09e-41 154 32 7 325 3 lysS Lysine--tRNA ligase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8EU10 1.3e-41 154 31 7 329 3 lysS Lysine--tRNA ligase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A2C629 1.31e-41 154 34 9 328 3 lysS Lysine--tRNA ligase Prochlorococcus marinus (strain MIT 9303)
A5WFG0 1.34e-41 154 31 5 322 3 lysS Lysine--tRNA ligase Psychrobacter sp. (strain PRwf-1)
Q7NC34 1.43e-41 154 30 7 319 3 lysS Lysine--tRNA ligase Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q5X4D5 1.66e-41 153 32 5 323 3 lysS Lysine--tRNA ligase Legionella pneumophila (strain Paris)
A0AF28 1.67e-41 153 32 7 326 3 lysS Lysine--tRNA ligase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
B0TTP2 1.94e-41 153 33 8 335 3 lysS Lysine--tRNA ligase Shewanella halifaxensis (strain HAW-EB4)
P0A8N5 1.95e-41 153 34 7 326 1 lysU Lysine--tRNA ligase, heat inducible Escherichia coli (strain K12)
P0A8N6 1.95e-41 153 34 7 326 3 lysU Lysine--tRNA ligase, heat inducible Escherichia coli O157:H7
Q5WVS0 2.1e-41 153 33 7 327 3 lysS Lysine--tRNA ligase Legionella pneumophila (strain Lens)
A7HM68 2.14e-41 153 32 7 329 3 lysS Lysine--tRNA ligase Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
A1AWN8 2.22e-41 153 31 8 326 3 lysS Lysine--tRNA ligase Ruthia magnifica subsp. Calyptogena magnifica
Q8FAT5 2.42e-41 153 34 7 326 3 lysU Lysine--tRNA ligase, heat inducible Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9LJE2 2.47e-41 154 33 10 352 2 OVA5 Lysine--tRNA ligase, chloroplastic/mitochondrial Arabidopsis thaliana
P75500 2.59e-41 153 30 7 327 3 lysS Lysine--tRNA ligase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
A5EY50 3.73e-41 152 32 6 323 3 lysS Lysine--tRNA ligase Dichelobacter nodosus (strain VCS1703A)
A3QB36 3.8e-41 152 33 8 335 3 lysS Lysine--tRNA ligase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q7VFL0 4.49e-41 152 33 11 332 3 lysS Lysine--tRNA ligase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q8RG52 4.61e-41 152 31 8 326 3 lysS Lysine--tRNA ligase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q5ZUL6 5.29e-41 152 32 5 323 3 lysS Lysine--tRNA ligase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5ICT2 5.29e-41 152 32 5 323 3 lysS Lysine--tRNA ligase Legionella pneumophila (strain Corby)
A7MR65 5.68e-41 152 32 7 329 3 lysS Lysine--tRNA ligase Cronobacter sakazakii (strain ATCC BAA-894)
Q1QAW5 5.95e-41 152 33 10 334 3 lysS Lysine--tRNA ligase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q7U3A4 5.99e-41 152 33 9 328 3 lysS Lysine--tRNA ligase Prochlorococcus marinus (strain MIT 9313)
A1JPL4 6.1e-41 152 31 5 323 3 lysS Lysine--tRNA ligase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B6YRR7 6.16e-41 152 31 9 326 3 lysS Lysine--tRNA ligase Azobacteroides pseudotrichonymphae genomovar. CFP2
Q050Q1 6.88e-41 152 32 8 330 3 lysS Lysine--tRNA ligase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04SM4 6.88e-41 152 32 8 330 3 lysS Lysine--tRNA ligase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
B1JPH6 7.19e-41 152 31 6 325 3 lysS Lysine--tRNA ligase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q666T3 7.19e-41 152 31 6 325 3 lysS Lysine--tRNA ligase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TIC5 7.19e-41 152 31 6 325 3 lysS Lysine--tRNA ligase Yersinia pestis (strain Pestoides F)
Q1CF16 7.19e-41 152 31 6 325 3 lysS Lysine--tRNA ligase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R4M4 7.19e-41 152 31 6 325 3 lysS Lysine--tRNA ligase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZHK5 7.19e-41 152 31 6 325 3 lysS Lysine--tRNA ligase Yersinia pestis
B2K0N6 7.19e-41 152 31 6 325 3 lysS Lysine--tRNA ligase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CB23 7.19e-41 152 31 6 325 3 lysS Lysine--tRNA ligase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FF39 7.19e-41 152 31 6 325 3 lysS Lysine--tRNA ligase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q9ZMP8 7.44e-41 152 33 7 332 3 lysS Lysine--tRNA ligase Helicobacter pylori (strain J99 / ATCC 700824)
Q7N1C8 8.61e-41 152 31 6 326 3 lysS Lysine--tRNA ligase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6LUN2 8.81e-41 152 32 8 332 3 lysS Lysine--tRNA ligase Photobacterium profundum (strain SS9)
A4WE42 9.99e-41 151 32 7 329 3 lysS Lysine--tRNA ligase Enterobacter sp. (strain 638)
C5BRM0 1.27e-40 151 32 6 328 3 lysS Lysine--tRNA ligase Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q2P1U6 1.47e-40 151 32 5 328 3 lysS Lysine--tRNA ligase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B2RJY1 1.93e-40 152 32 8 324 3 lysS Lysine--tRNA ligase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
A9MRI4 2.07e-40 150 31 7 329 3 lysS Lysine--tRNA ligase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q9KGG4 2.12e-40 150 32 8 323 3 lysS Lysine--tRNA ligase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
C4LCP0 2.31e-40 150 31 7 332 3 lysS Lysine--tRNA ligase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q3M8C8 3.04e-40 151 32 5 322 3 lysS Lysine--tRNA ligase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
A8GIP4 3.05e-40 150 31 5 323 3 lysS Lysine--tRNA ligase Serratia proteamaculans (strain 568)
Q9KU60 3.14e-40 150 31 6 332 3 lysS Lysine--tRNA ligase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A6UDA0 3.42e-40 150 31 8 325 3 lysS Lysine--tRNA ligase Sinorhizobium medicae (strain WSM419)
B1HSY5 3.63e-40 150 31 7 329 3 lysS Lysine--tRNA ligase Lysinibacillus sphaericus (strain C3-41)
A8AP96 4.64e-40 150 31 6 329 3 lysS Lysine--tRNA ligase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
C0PY12 6.64e-40 149 33 8 326 3 lysS Lysine--tRNA ligase Salmonella paratyphi C (strain RKS4594)
Q8YPW9 7.2e-40 150 32 5 322 3 lysS Lysine--tRNA ligase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
B4TUQ8 7.9e-40 149 32 8 329 3 lysS Lysine--tRNA ligase Salmonella schwarzengrund (strain CVM19633)
B5BFK5 7.9e-40 149 32 8 329 3 lysS Lysine--tRNA ligase Salmonella paratyphi A (strain AKU_12601)
A9N3L6 7.9e-40 149 32 8 329 3 lysS Lysine--tRNA ligase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PL30 7.9e-40 149 32 8 329 3 lysS Lysine--tRNA ligase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T535 7.9e-40 149 32 8 329 3 lysS Lysine--tRNA ligase Salmonella newport (strain SL254)
B4TGW0 7.9e-40 149 32 8 329 3 lysS Lysine--tRNA ligase Salmonella heidelberg (strain SL476)
B5RE01 7.9e-40 149 32 8 329 3 lysS Lysine--tRNA ligase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QXG7 7.9e-40 149 32 8 329 3 lysS Lysine--tRNA ligase Salmonella enteritidis PT4 (strain P125109)
B5FUF3 7.9e-40 149 32 8 329 3 lysS Lysine--tRNA ligase Salmonella dublin (strain CT_02021853)
Q57K76 7.9e-40 149 32 8 329 3 lysS Lysine--tRNA ligase Salmonella choleraesuis (strain SC-B67)
B5F5G4 7.9e-40 149 32 8 329 3 lysS Lysine--tRNA ligase Salmonella agona (strain SL483)
P28354 7.9e-40 149 32 8 329 3 lysS Lysine--tRNA ligase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q87SB1 8.15e-40 149 32 6 329 3 lysS Lysine--tRNA ligase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A5GI38 8.89e-40 149 32 8 328 3 lysS Lysine--tRNA ligase Synechococcus sp. (strain WH7803)
B0V9L5 8.97e-40 149 31 5 320 3 lysS Lysine--tRNA ligase Acinetobacter baumannii (strain AYE)
B0VSE0 8.97e-40 149 31 5 320 3 lysS Lysine--tRNA ligase Acinetobacter baumannii (strain SDF)
B7GXW0 8.97e-40 149 31 5 320 3 lysS Lysine--tRNA ligase Acinetobacter baumannii (strain AB307-0294)
A1K5J9 9.61e-40 149 33 8 327 3 lysS Lysine--tRNA ligase Azoarcus sp. (strain BH72)
Q8XD57 9.8e-40 149 34 9 327 3 lysS Lysine--tRNA ligase Escherichia coli O157:H7
Q8Z3X8 1.02e-39 149 32 8 329 3 lysS Lysine--tRNA ligase Salmonella typhi
Q7MAR1 1.07e-39 149 31 6 325 3 lysS Lysine--tRNA ligase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q4FSV2 1.15e-39 149 33 10 334 3 lysS Lysine--tRNA ligase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q8DEQ9 1.31e-39 149 31 6 329 3 lysS Lysine--tRNA ligase Vibrio vulnificus (strain CMCP6)
B0BP90 1.46e-39 148 31 8 332 3 lysS Lysine--tRNA ligase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N0G9 1.46e-39 148 31 8 332 3 lysS Lysine--tRNA ligase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
C5BAR6 1.49e-39 148 32 6 323 3 lysS Lysine--tRNA ligase Edwardsiella ictaluri (strain 93-146)
B1MVJ0 1.53e-39 148 31 7 322 3 lysS Lysine--tRNA ligase Leuconostoc citreum (strain KM20)
A7MXL2 1.58e-39 148 31 6 329 3 lysS Lysine--tRNA ligase Vibrio campbellii (strain ATCC BAA-1116)
O87821 1.61e-39 148 31 8 325 3 lysS Lysine--tRNA ligase Rhizobium meliloti (strain 1021)
Q7MNP6 1.63e-39 148 31 6 329 3 lysS Lysine--tRNA ligase Vibrio vulnificus (strain YJ016)
B7ID87 1.63e-39 148 31 9 324 3 lysS Lysine--tRNA ligase Thermosipho africanus (strain TCF52B)
Q057G7 1.75e-39 148 29 9 326 3 lysS Lysine--tRNA ligase Buchnera aphidicola subsp. Cinara cedri (strain Cc)
A3M3D6 1.99e-39 148 31 5 320 3 lysS Lysine--tRNA ligase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
Q7V9Q0 2.04e-39 148 31 7 328 3 lysS Lysine--tRNA ligase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
B2J384 2.1e-39 149 31 8 326 3 lysS Lysine--tRNA ligase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q8K9C5 2.65e-39 147 29 9 332 3 lysS Lysine--tRNA ligase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q318C3 2.7e-39 148 30 8 329 3 lysS Lysine--tRNA ligase Prochlorococcus marinus (strain MIT 9312)
B3H1E8 2.81e-39 147 31 8 332 3 lysS Lysine--tRNA ligase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q32BV3 3.14e-39 147 32 10 330 3 lysS Lysine--tRNA ligase Shigella dysenteriae serotype 1 (strain Sd197)
B1LAX6 3.37e-39 147 32 7 328 3 lysS Lysine--tRNA ligase Thermotoga sp. (strain RQ2)
A5ILE6 3.37e-39 147 32 7 328 3 lysS Lysine--tRNA ligase Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
B5ZQW5 3.38e-39 147 32 8 325 3 lysS Lysine--tRNA ligase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
P0A8N3 3.51e-39 147 32 10 330 1 lysS Lysine--tRNA ligase Escherichia coli (strain K12)
P0A8N4 3.51e-39 147 32 10 330 3 lysS Lysine--tRNA ligase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1S9M3 3.6e-39 147 32 6 329 3 lysS Lysine--tRNA ligase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q31WF2 3.97e-39 147 32 10 330 3 lysS Lysine--tRNA ligase Shigella boydii serotype 4 (strain Sb227)
Q087X1 4.32e-39 147 32 8 335 3 lysS Lysine--tRNA ligase Shewanella frigidimarina (strain NCIMB 400)
Q9X231 4.53e-39 147 32 7 328 3 lysS Lysine--tRNA ligase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q02RH2 4.66e-39 147 30 7 322 3 lysS Lysine--tRNA ligase Pseudomonas aeruginosa (strain UCBPP-PA14)
Q0T106 4.72e-39 147 32 10 330 3 lysS Lysine--tRNA ligase Shigella flexneri serotype 5b (strain 8401)
B2U0Q7 4.72e-39 147 32 10 330 3 lysS Lysine--tRNA ligase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q83JU6 4.72e-39 147 32 10 330 3 lysS Lysine--tRNA ligase Shigella flexneri
Q89AC5 4.99e-39 147 31 9 331 3 lysS Lysine--tRNA ligase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B7V0Z5 6.14e-39 147 31 8 322 3 lysS Lysine--tRNA ligase Pseudomonas aeruginosa (strain LESB58)
A6V187 6.46e-39 146 30 7 322 3 lysS Lysine--tRNA ligase Pseudomonas aeruginosa (strain PA7)
Q0SQ86 6.87e-39 146 30 7 327 3 lysS Lysine--tRNA ligase Clostridium perfringens (strain SM101 / Type A)
Q9HXU0 6.94e-39 146 31 8 322 3 lysS Lysine--tRNA ligase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8XHL8 7.23e-39 146 30 7 327 3 lysS Lysine--tRNA ligase Clostridium perfringens (strain 13 / Type A)
Q0TMI7 7.53e-39 146 30 6 325 3 lysS Lysine--tRNA ligase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q0HRS5 8.48e-39 146 32 8 335 3 lysS Lysine--tRNA ligase Shewanella sp. (strain MR-7)
Q0HM10 8.48e-39 146 32 8 335 3 lysS Lysine--tRNA ligase Shewanella sp. (strain MR-4)
A0L0F1 8.48e-39 146 32 8 335 3 lysS Lysine--tRNA ligase Shewanella sp. (strain ANA-3)
Q8EI58 8.57e-39 146 32 7 331 3 lysS Lysine--tRNA ligase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q03Z44 8.59e-39 146 31 7 323 3 lysS Lysine--tRNA ligase Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
A1RGF1 8.74e-39 146 32 7 331 3 lysS Lysine--tRNA ligase Shewanella sp. (strain W3-18-1)
A4Y9X9 8.74e-39 146 32 7 331 3 lysS Lysine--tRNA ligase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q6MUG2 9.02e-39 146 30 6 320 3 lysS Lysine--tRNA ligase Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q2NRG1 1.52e-38 145 31 6 323 3 lysS Lysine--tRNA ligase Sodalis glossinidius (strain morsitans)
B3Q0S4 1.76e-38 145 32 7 325 3 lysS Lysine--tRNA ligase Rhizobium etli (strain CIAT 652)
Q9L3G6 1.97e-38 145 32 5 328 3 lysS Lysine--tRNA ligase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UU84 1.97e-38 145 32 5 328 3 lysS Lysine--tRNA ligase Xanthomonas campestris pv. campestris (strain 8004)
Q12JH2 2.04e-38 145 31 8 334 3 lysS Lysine--tRNA ligase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q64PM9 2.04e-38 146 30 9 324 3 lysS Lysine--tRNA ligase Bacteroides fragilis (strain YCH46)
A9L1I0 2.1e-38 145 31 8 335 3 lysS Lysine--tRNA ligase Shewanella baltica (strain OS195)
A6WS29 2.1e-38 145 31 8 335 3 lysS Lysine--tRNA ligase Shewanella baltica (strain OS185)
A3D0Y5 2.1e-38 145 31 8 335 3 lysS Lysine--tRNA ligase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B0RSQ8 2.2e-38 145 32 5 328 3 lysS Lysine--tRNA ligase Xanthomonas campestris pv. campestris (strain B100)
Q5L9E5 2.31e-38 146 30 9 324 3 lysS Lysine--tRNA ligase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q8Y0L5 2.45e-38 145 31 7 324 3 lysS Lysine--tRNA ligase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q7MUV7 2.5e-38 146 31 8 324 3 lysS Lysine--tRNA ligase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2U8U9 2.66e-38 145 31 7 329 3 lysS Lysine--tRNA ligase Ralstonia pickettii (strain 12J)
A0M5H8 2.79e-38 145 30 7 324 3 lysS Lysine--tRNA ligase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
B2SV97 3.82e-38 144 32 5 328 3 lysS Lysine--tRNA ligase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q031U8 4.12e-38 144 30 6 325 3 lysS Lysine--tRNA ligase Lactococcus lactis subsp. cremoris (strain SK11)
Q2NJZ8 4.15e-38 144 32 9 328 3 lysS Lysine--tRNA ligase Aster yellows witches'-broom phytoplasma (strain AYWB)
Q8PLC6 4.41e-38 144 31 5 328 3 lysS Lysine--tRNA ligase Xanthomonas axonopodis pv. citri (strain 306)
Q2K424 4.72e-38 144 32 11 333 3 lysS Lysine--tRNA ligase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
A2RIA0 4.81e-38 144 30 6 325 3 lysS Lysine--tRNA ligase Lactococcus lactis subsp. cremoris (strain MG1363)
C5CSG3 5.67e-38 144 32 7 326 3 lysS Lysine--tRNA ligase Variovorax paradoxus (strain S110)
D0LB45 5.92e-38 147 31 9 328 3 lysX Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX Gordonia bronchialis (strain ATCC 25592 / DSM 43247 / BCRC 13721 / JCM 3198 / KCTC 3076 / NBRC 16047 / NCTC 10667)
B1JD39 6.45e-38 144 32 12 328 3 lysS Lysine--tRNA ligase Pseudomonas putida (strain W619)
Q493E1 6.49e-38 144 30 6 328 3 lysS Lysine--tRNA ligase Blochmanniella pennsylvanica (strain BPEN)
A4XXQ6 6.83e-38 144 31 8 322 3 lysS Lysine--tRNA ligase Pseudomonas mendocina (strain ymp)
Q9CII7 6.94e-38 144 30 6 325 3 lysS Lysine--tRNA ligase Lactococcus lactis subsp. lactis (strain IL1403)
Q98QH1 7.15e-38 144 31 9 326 3 lysS1 Lysine--tRNA ligase 1 Mycoplasmopsis pulmonis (strain UAB CTIP)
Q5NY31 8.04e-38 144 31 6 324 3 lysS Lysine--tRNA ligase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q8A5W4 8.25e-38 144 29 5 321 3 lysS Lysine--tRNA ligase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q2SR35 8.41e-38 144 29 7 324 3 lysS Lysine--tRNA ligase Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q1MBK9 8.98e-38 143 31 8 326 3 lysS Lysine--tRNA ligase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A5UPG6 1.06e-37 143 31 6 325 3 lysS Lysine--tRNA ligase Roseiflexus sp. (strain RS-1)
A5W890 1.12e-37 143 32 12 328 3 lysS Lysine--tRNA ligase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A2SDC3 1.19e-37 143 31 7 330 3 lysS Lysine--tRNA ligase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q47C53 1.2e-37 143 33 9 326 3 lysS Lysine--tRNA ligase Dechloromonas aromatica (strain RCB)
Q1IDW1 1.3e-37 143 31 10 323 3 lysS Lysine--tRNA ligase Pseudomonas entomophila (strain L48)
Q1LTU4 1.45e-37 143 30 8 336 3 lysS Lysine--tRNA ligase Baumannia cicadellinicola subsp. Homalodisca coagulata
Q3BUB6 1.46e-37 143 31 6 330 3 lysS Lysine--tRNA ligase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
A9B5T5 1.59e-37 142 31 6 319 3 lysS Lysine--tRNA ligase Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
Q88MS3 1.63e-37 143 32 12 328 3 lysS Lysine--tRNA ligase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q2SL47 1.77e-37 143 31 8 336 3 lysS Lysine--tRNA ligase Hahella chejuensis (strain KCTC 2396)
A8AW92 1.93e-37 142 30 6 325 3 lysS Lysine--tRNA ligase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q9UUE6 2.07e-37 144 30 7 336 3 krs1 Lysine--tRNA ligase, cytoplasmic Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A7NFC6 2.25e-37 142 31 6 325 3 lysS Lysine--tRNA ligase Roseiflexus castenholzii (strain DSM 13941 / HLO8)
A6L7P5 2.53e-37 143 28 7 323 3 lysS Lysine--tRNA ligase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q98QG4 2.56e-37 142 32 9 324 3 lysS2 Lysine--tRNA ligase 2 Mycoplasmopsis pulmonis (strain UAB CTIP)
Q43990 2.83e-37 142 31 4 319 3 lysS Lysine--tRNA ligase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q97RS9 2.94e-37 142 30 7 325 1 lysS Lysine--tRNA ligase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q8CWS5 3.03e-37 142 30 7 325 3 lysS Lysine--tRNA ligase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B5E317 3.03e-37 142 30 7 325 3 lysS Lysine--tRNA ligase Streptococcus pneumoniae serotype 19F (strain G54)
Q04LI2 3.03e-37 142 30 7 325 3 lysS Lysine--tRNA ligase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
B0KRL5 3.19e-37 142 32 12 328 3 lysS Lysine--tRNA ligase Pseudomonas putida (strain GB-1)
A9BD62 3.56e-37 142 30 7 323 3 lysS Lysine--tRNA ligase Prochlorococcus marinus (strain MIT 9211)
Q6YPY6 3.67e-37 142 32 8 327 3 lysS Lysine--tRNA ligase Onion yellows phytoplasma (strain OY-M)
Q473I5 4.19e-37 142 30 7 324 3 lysS Lysine--tRNA ligase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q8U7H6 4.32e-37 141 31 6 325 3 lysS Lysine--tRNA ligase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q3B0J9 4.72e-37 141 32 9 328 3 lysS Lysine--tRNA ligase Synechococcus sp. (strain CC9902)
B3R478 6.68e-37 141 30 7 324 3 lysS Lysine--tRNA ligase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
B1IAN6 7.8e-37 141 30 6 325 3 lysS Lysine--tRNA ligase Streptococcus pneumoniae (strain Hungary19A-6)
A3CP17 8.37e-37 140 29 7 325 3 lysS Lysine--tRNA ligase Streptococcus sanguinis (strain SK36)
Q5WLU5 8.86e-37 140 30 6 322 3 lysS Lysine--tRNA ligase Shouchella clausii (strain KSM-K16)
A4VTP6 1.03e-36 140 30 7 324 3 lysS Lysine--tRNA ligase Streptococcus suis (strain 05ZYH33)
A4VZY0 1.03e-36 140 30 7 324 3 lysS Lysine--tRNA ligase Streptococcus suis (strain 98HAH33)
Q1LPK6 1.06e-36 140 30 8 328 3 lysS Lysine--tRNA ligase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B2IN95 1.16e-36 140 30 7 324 3 lysS Lysine--tRNA ligase Streptococcus pneumoniae (strain CGSP14)
Q48F26 1.2e-36 140 31 9 322 3 lysS Lysine--tRNA ligase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4ZWW0 1.28e-36 140 29 5 319 3 lysS Lysine--tRNA ligase Pseudomonas syringae pv. syringae (strain B728a)
Q886S6 1.35e-36 140 30 8 322 3 lysS Lysine--tRNA ligase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q7WK46 1.44e-36 140 31 8 327 3 lysS Lysine--tRNA ligase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A6LMS4 1.61e-36 140 30 7 323 3 lysS Lysine--tRNA ligase Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Q7VZ37 1.68e-36 140 31 8 327 3 lysS Lysine--tRNA ligase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q5Z3P6 1.87e-36 142 31 8 329 3 lysX Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX Nocardia farcinica (strain IFM 10152)
Q0KCG3 2.15e-36 140 30 7 324 3 lysS Lysine--tRNA ligase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q3KHF3 2.38e-36 139 30 8 322 3 lysS Lysine--tRNA ligase Pseudomonas fluorescens (strain Pf0-1)
Q4KHL4 2.66e-36 139 30 7 323 3 lysS Lysine--tRNA ligase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A1KUN1 2.97e-36 139 29 6 325 3 lysS Lysine--tRNA ligase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
A8ESJ5 3.16e-36 139 30 8 330 3 lysS Lysine--tRNA ligase Aliarcobacter butzleri (strain RM4018)
Q03LD3 3.23e-36 139 30 6 324 3 lysS Lysine--tRNA ligase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q9JYU6 3.28e-36 139 29 6 325 3 lysS Lysine--tRNA ligase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JTT7 3.39e-36 139 29 6 325 3 lysS Lysine--tRNA ligase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
B4RP57 4.45e-36 139 29 6 325 3 lysS Lysine--tRNA ligase Neisseria gonorrhoeae (strain NCCP11945)
Q5F6U2 4.54e-36 139 29 6 325 3 lysS Lysine--tRNA ligase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A9IQY2 6.25e-36 139 31 8 327 3 lysS Lysine--tRNA ligase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
C0ZL89 6.29e-36 141 32 8 328 3 lysX Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q7W8T6 6.45e-36 138 31 8 327 3 lysS Lysine--tRNA ligase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q22099 7.59e-36 139 30 4 338 3 kars-1 Lysine--tRNA ligase Caenorhabditis elegans
Q9A0V7 8.93e-36 138 30 7 325 3 lysS Lysine--tRNA ligase Streptococcus pyogenes serotype M1
A9CS74 1.16e-35 138 31 9 340 3 EBI_25548 Probable lysine--tRNA ligase, cytoplasmic Enterocytozoon bieneusi (strain H348)
B1VA97 1.21e-35 137 30 11 328 3 lysS Lysine--tRNA ligase Phytoplasma australiense
P0DG47 1.27e-35 137 30 7 325 3 lysS Lysine--tRNA ligase Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DG46 1.27e-35 137 30 7 325 3 lysS Lysine--tRNA ligase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
B5XKG9 1.38e-35 137 30 7 325 3 lysS Lysine--tRNA ligase Streptococcus pyogenes serotype M49 (strain NZ131)
A6L8C6 1.46e-35 138 30 9 326 3 lysS Lysine--tRNA ligase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
A2RFR7 1.5e-35 137 30 7 325 3 lysS Lysine--tRNA ligase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q8P1X6 1.5e-35 137 30 7 325 3 lysS Lysine--tRNA ligase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XD62 1.5e-35 137 30 7 325 3 lysS Lysine--tRNA ligase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
A5U8S4 2.14e-35 137 32 9 328 3 lysS Lysine--tRNA ligase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AI57 2.14e-35 137 32 9 328 3 lysS Lysine--tRNA ligase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KPT4 2.14e-35 137 32 9 328 3 lysS Lysine--tRNA ligase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P9WFU9 2.14e-35 137 32 9 328 1 lysS1 Lysine--tRNA ligase 1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFU8 2.14e-35 137 32 9 328 3 lysS1 Lysine--tRNA ligase 1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P67608 2.14e-35 137 32 9 328 3 lysS1 Lysine--tRNA ligase 1 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q13WZ5 2.28e-35 137 30 8 332 3 lysS Lysine--tRNA ligase Paraburkholderia xenovorans (strain LB400)
A8F4K1 2.32e-35 137 30 9 331 3 lysS Lysine--tRNA ligase Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
Q899G7 2.86e-35 137 28 6 328 3 lysS Lysine--tRNA ligase Clostridium tetani (strain Massachusetts / E88)
Q7NZ62 3.75e-35 136 29 7 330 3 lysS Lysine--tRNA ligase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A9AGV1 5.84e-35 136 30 7 324 3 lysS Lysine--tRNA ligase Burkholderia multivorans (strain ATCC 17616 / 249)
A3Q0V0 7.76e-35 137 31 11 328 3 lysX Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX Mycobacterium sp. (strain JLS)
Q3K1V5 8.67e-35 135 30 8 325 3 lysS Lysine--tRNA ligase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
C1B7Z5 8.88e-35 137 31 7 327 3 lysX Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX Rhodococcus opacus (strain B4)
B2JIY1 9.62e-35 135 30 9 331 3 lysS Lysine--tRNA ligase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q8E0I1 9.69e-35 135 30 8 325 3 lysS Lysine--tRNA ligase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E656 9.69e-35 135 30 8 325 3 lysS Lysine--tRNA ligase Streptococcus agalactiae serotype III (strain NEM316)
A4JFZ6 1.07e-34 135 30 7 324 3 lysS Lysine--tRNA ligase Burkholderia vietnamiensis (strain G4 / LMG 22486)
C1DB68 1.1e-34 135 29 5 322 3 lysS Lysine--tRNA ligase Laribacter hongkongensis (strain HLHK9)
Q0SAA3 1.32e-34 137 31 7 327 3 lysX Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX Rhodococcus jostii (strain RHA1)
Q1B7P4 1.61e-34 137 30 9 330 3 lysX Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX Mycobacterium sp. (strain MCS)
A1UHB3 1.61e-34 137 30 9 330 3 lysX Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX Mycobacterium sp. (strain KMS)
B2SXV7 1.71e-34 135 29 8 332 3 lysS Lysine--tRNA ligase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A5I7P4 2.34e-34 134 28 7 336 3 lysS Lysine--tRNA ligase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FZA5 2.34e-34 134 28 7 336 3 lysS Lysine--tRNA ligase Clostridium botulinum (strain ATCC 19397 / Type A)
Q87EB3 2.46e-34 134 30 6 329 3 lysS Lysine--tRNA ligase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I848 2.46e-34 134 30 6 329 3 lysS Lysine--tRNA ligase Xylella fastidiosa (strain M23)
Q4AAC7 2.53e-34 134 29 7 325 3 lysS Lysine--tRNA ligase Mesomycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110)
B0U572 2.78e-34 134 30 6 329 3 lysS Lysine--tRNA ligase Xylella fastidiosa (strain M12)
A4T9U2 3.25e-34 136 30 8 329 3 lysX Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX Mycolicibacterium gilvum (strain PYR-GCK)
P46861 3.65e-34 134 31 11 333 3 lysS Lysine--tRNA ligase Mycobacterium leprae (strain TN)
P95970 3.85e-34 133 29 7 322 3 lysS Lysine--tRNA ligase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q9Z6X5 4.03e-34 134 29 6 336 3 lysS Lysine--tRNA ligase Chlamydia pneumoniae
Q9PEB6 4.69e-34 133 30 6 329 3 lysS Lysine--tRNA ligase Xylella fastidiosa (strain 9a5c)
Q5L545 4.93e-34 134 31 10 338 3 lysS Lysine--tRNA ligase Chlamydia abortus (strain DSM 27085 / S26/3)
Q8DUW8 5.5e-34 133 28 5 324 3 lysS Lysine--tRNA ligase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q2SXD6 6.61e-34 133 30 7 324 1 lysS Lysine--tRNA ligase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q1H372 6.61e-34 133 31 9 328 3 lysS Lysine--tRNA ligase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q0BDR2 7.02e-34 133 29 7 324 3 lysS Lysine--tRNA ligase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YT20 7.02e-34 133 29 7 324 3 lysS Lysine--tRNA ligase Burkholderia ambifaria (strain MC40-6)
Q3JQP3 8.75e-34 132 30 7 329 3 lysS Lysine--tRNA ligase Burkholderia pseudomallei (strain 1710b)
Q63SN9 8.84e-34 132 30 7 329 3 lysS Lysine--tRNA ligase Burkholderia pseudomallei (strain K96243)
A3NB96 9.78e-34 132 30 7 329 3 lysS Lysine--tRNA ligase Burkholderia pseudomallei (strain 668)
A3NX27 1.04e-33 132 30 7 329 3 lysS Lysine--tRNA ligase Burkholderia pseudomallei (strain 1106a)
A1V5L6 1.04e-33 132 30 7 329 3 lysS Lysine--tRNA ligase Burkholderia mallei (strain SAVP1)
Q62IZ9 1.04e-33 132 30 7 329 3 lysS Lysine--tRNA ligase Burkholderia mallei (strain ATCC 23344)
A2SAT3 1.04e-33 132 30 7 329 3 lysS Lysine--tRNA ligase Burkholderia mallei (strain NCTC 10229)
A3ML91 1.04e-33 132 30 7 329 3 lysS Lysine--tRNA ligase Burkholderia mallei (strain NCTC 10247)
Q4A8F8 1.2e-33 132 29 7 325 3 lysS Lysine--tRNA ligase Mesomycoplasma hyopneumoniae (strain 7448)
Q1BHT1 1.22e-33 132 29 7 324 3 lysS Lysine--tRNA ligase Burkholderia orbicola (strain AU 1054)
B1JUZ7 1.22e-33 132 29 7 324 3 lysS Lysine--tRNA ligase Burkholderia orbicola (strain MC0-3)
A0K8P2 1.22e-33 132 29 7 324 3 lysS Lysine--tRNA ligase Burkholderia cenocepacia (strain HI2424)
B4EDB2 1.35e-33 132 29 7 324 3 lysS Lysine--tRNA ligase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q99MN1 1.4e-33 133 29 5 330 1 Kars1 Lysine--tRNA ligase Mus musculus
A0PXN4 1.4e-33 132 28 7 330 3 lysS Lysine--tRNA ligase Clostridium novyi (strain NT)
P57512 1.43e-33 132 30 8 325 3 lysS Lysine--tRNA ligase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P37879 1.48e-33 133 28 3 330 1 KARS1 Lysine--tRNA ligase Cricetulus griseus
Q6KIP6 1.49e-33 132 29 7 326 3 lysS Lysine--tRNA ligase Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
A4SYX2 1.6e-33 132 30 10 335 3 lysS Lysine--tRNA ligase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A4T5M9 1.72e-33 132 32 9 328 3 lysS Lysine--tRNA ligase Mycolicibacterium gilvum (strain PYR-GCK)
Q4A5F3 1.96e-33 131 30 10 329 3 lysS Lysine--tRNA ligase Mycoplasmopsis synoviae (strain 53)
Q821U6 2e-33 132 29 7 335 3 lysS Lysine--tRNA ligase Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q9CC23 2.05e-33 134 29 8 337 3 lysX Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX Mycobacterium leprae (strain TN)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_11110
Feature type CDS
Gene epmA
Product elongation factor P--(R)-beta-lysine ligase
Location 8034 - 9011 (strand: 1)
Length 978 (nucleotides) / 325 (amino acids)

Contig

Accession ZDB_368
Length 188522 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2046
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00152 tRNA synthetases class II (D, K and N)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2269 Translation, ribosomal structure and biogenesis (J) J Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K04568 elongation factor P--(R)-beta-lysine ligase [EC:6.3.1.-] - -

Protein Sequence

MSDIAGWQPTAPIANLLKRAKIVNEIRHFFADRGVLEVETPTMSQATVTDVHLRAFETQFTGPGAAQGITLYLMTSPEYHMKRLLAAGSGPIYQMGRSYRNEEAGRYHNPEFTMLEWYRPHYDMYRLINEVDDLLQQTLECESAESLSYQQAFLRYLDIDPLTAEKDKLREVAAKLDVSNIADTEEDRDTILQLLFMVGVEPHIGLEKPTFIYHFPASQASLAEISSEDHRVAERFEVYYKGVELANGFRELTDAAEQRQRFERDNRKRASMGLPEQPIDENLLAALEHGFPECAGVALGIDRLIMLALGAERISDVIAFPVDRA

Flanking regions ( +/- flanking 50bp)

GAGGTTGCGGGTAAACTGCACCCTTTATTTTTATTCGGAGTTCTTACGGCATGAGTGATATTGCGGGCTGGCAGCCGACTGCCCCGATAGCCAATCTATTAAAACGCGCAAAAATTGTTAATGAAATCAGACATTTTTTTGCAGACAGAGGTGTATTAGAAGTCGAAACGCCGACCATGAGTCAGGCGACCGTCACCGATGTCCATCTGCGCGCCTTTGAAACTCAGTTTACCGGCCCCGGAGCCGCACAGGGAATAACGCTTTATCTGATGACCAGCCCGGAATACCACATGAAACGGTTACTGGCAGCGGGCAGCGGCCCCATTTATCAGATGGGCCGCAGCTATCGTAACGAGGAAGCCGGACGCTATCATAATCCGGAGTTCACCATGCTCGAATGGTATCGTCCTCATTATGATATGTACCGTCTGATAAATGAGGTTGATGATTTATTACAGCAAACCTTAGAGTGTGAAAGTGCAGAATCGTTATCCTACCAGCAGGCTTTCCTGCGCTACCTGGATATCGATCCGCTGACCGCTGAGAAAGACAAACTGCGTGAAGTTGCGGCCAAACTGGATGTCAGCAACATTGCCGATACCGAGGAAGATCGCGATACCATTTTACAGTTGCTGTTTATGGTGGGTGTGGAGCCGCATATCGGGCTGGAAAAACCGACCTTTATTTATCACTTCCCGGCAAGCCAGGCGTCACTGGCGGAGATCAGCTCTGAAGATCACCGCGTGGCCGAGCGCTTTGAAGTGTATTACAAAGGGGTTGAACTGGCAAACGGCTTCCGTGAACTGACTGATGCCGCAGAGCAGCGTCAGCGCTTTGAACGGGATAACCGCAAACGGGCAAGTATGGGTCTGCCGGAGCAGCCGATTGATGAAAATCTGCTGGCAGCACTTGAACACGGATTCCCGGAATGTGCCGGTGTGGCACTGGGGATTGACCGCCTGATTATGCTCGCACTGGGTGCAGAGCGGATCAGTGATGTGATCGCCTTCCCGGTTGATCGCGCATAATACCTCCTTCAGCCATCTGTTATGCAGATGGCTGCTTCTCTTTTCTTCAT