Homologs in group_3483

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16765 FBDBKF_16765 100.0 Morganella morganii S1 eamA EamA domain-containing protein
EHELCC_10695 EHELCC_10695 100.0 Morganella morganii S2 eamA EamA domain-containing protein
NLDBIP_11040 NLDBIP_11040 100.0 Morganella morganii S4 eamA EamA domain-containing protein
HKOGLL_16480 HKOGLL_16480 100.0 Morganella morganii S5 eamA EamA domain-containing protein

Distribution of the homologs in the orthogroup group_3483

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3483

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_10315
Feature type CDS
Gene eamA
Product EamA domain-containing protein
Location 31813 - 32112 (strand: -1)
Length 300 (nucleotides) / 99 (amino acids)
In genomic island -

Contig

Accession ZDB_367
Length 191445 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3483
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MSKITILQLIRVAATVTGASSLIYLTAGYESALNHEITAFSLPLLLWRVMLYSAAGVFWCYRLRPRLRLACPAHRIRRAECLMICLVISGELSGLLRRL

Flanking regions ( +/- flanking 50bp)

GTACATCAGAATGACGGCGCACTGCACCGGCTGAATCATAAGGCGGTGCCATGAGCAAAATAACCATACTGCAACTGATCAGAGTGGCAGCCACTGTGACCGGTGCCAGTTCACTGATATATCTGACGGCAGGTTATGAGTCCGCGCTGAATCACGAAATCACGGCGTTCAGTCTGCCGTTGCTGCTCTGGCGGGTGATGCTGTACAGCGCGGCAGGGGTTTTCTGGTGTTACCGCCTCCGGCCGCGTCTCCGGTTGGCCTGCCCGGCACACAGGATACGCCGTGCTGAATGCCTGATGATTTGCCTGGTGATATCGGGTGAACTCAGCGGCCTGCTGCGGAGGCTGTGATGACGGCAGACAGTTATCTTGAGCTTGTGCTGGTCTTTATGGGCTGGCTG