Homologs in group_3482

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16765 FBDBKF_16765 100.0 Morganella morganii S1 eamA EamA domain-containing protein
EHELCC_10695 EHELCC_10695 100.0 Morganella morganii S2 eamA EamA domain-containing protein
NLDBIP_11040 NLDBIP_11040 100.0 Morganella morganii S4 eamA EamA domain-containing protein
LHKJJB_10315 LHKJJB_10315 100.0 Morganella morganii S3 eamA EamA domain-containing protein

Distribution of the homologs in the orthogroup group_3482

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3482

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_16480
Feature type CDS
Gene eamA
Product EamA domain-containing protein
Location 31822 - 32121 (strand: -1)
Length 300 (nucleotides) / 99 (amino acids)

Contig

Accession ZDB_697
Length 66671 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3482
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MSKITILQLIRVAATVTGASSLIYLTAGYESALNHEITAFSLPLLLWRVMLYSAAGVFWCYRLRPRLRLACPAHRIRRAECLMICLVISGELSGLLRRL

Flanking regions ( +/- flanking 50bp)

GTACATCAGAATGACGGCGCACTGCACCGGCTGAATCATAAGGCGGTGCCATGAGCAAAATAACCATACTGCAACTGATCAGAGTGGCAGCCACTGTGACCGGTGCCAGTTCACTGATATATCTGACGGCAGGTTATGAGTCCGCGCTGAATCACGAAATCACGGCGTTCAGTCTGCCGTTGCTGCTCTGGCGGGTGATGCTGTACAGCGCGGCAGGGGTTTTCTGGTGTTACCGCCTCCGGCCGCGTCTCCGGTTGGCCTGCCCGGCACACAGGATACGCCGTGCTGAATGCCTGATGATTTGCCTGGTGATATCGGGTGAACTCAGCGGCCTGCTGCGGAGGCTGTGATGACGGCAGACAGTTATCTTGAGCTTGTGCTGGTCTTTATGGGCTGGCTG