Homologs in group_2343

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18805 FBDBKF_18805 100.0 Morganella morganii S1 htpX Zn-dependent protease with chaperone function
EHELCC_17000 EHELCC_17000 100.0 Morganella morganii S2 htpX Zn-dependent protease with chaperone function
NLDBIP_18380 NLDBIP_18380 100.0 Morganella morganii S4 htpX Zn-dependent protease with chaperone function
HKOGLL_08795 HKOGLL_08795 100.0 Morganella morganii S5 htpX Zn-dependent protease with chaperone function
F4V73_RS13790 F4V73_RS13790 82.0 Morganella psychrotolerans - M48 family metallopeptidase
PMI_RS17980 PMI_RS17980 69.6 Proteus mirabilis HI4320 - M48 family metallopeptidase

Distribution of the homologs in the orthogroup group_2343

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2343

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P25894 4.34e-105 307 57 1 249 1 loiP Metalloprotease LoiP Escherichia coli (strain K12)
P43674 2.38e-98 290 56 2 250 1 ycaL Metalloprotease YcaL Escherichia coli (strain K12)
Q8ZCC3 5.96e-09 59 24 8 222 3 bepA Beta-barrel assembly-enhancing protease Yersinia pestis
Q0BWV3 7.29e-09 58 26 10 228 3 htpX Protease HtpX homolog Hyphomonas neptunium (strain ATCC 15444)
P66949 8.81e-09 58 26 6 186 3 bepA Beta-barrel assembly-enhancing protease Shigella flexneri
P66948 8.81e-09 58 26 6 186 1 bepA Beta-barrel assembly-enhancing protease Escherichia coli (strain K12)
Q3JE43 1.45e-08 57 28 8 192 3 htpX Protease HtpX Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
O30795 1.79e-08 57 25 6 203 2 htpX Protease HtpX homolog Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
B9DTP5 1.91e-08 57 25 7 202 3 htpX Protease HtpX homolog Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q8XAD2 2.31e-08 57 26 6 186 3 bepA Beta-barrel assembly-enhancing protease Escherichia coli O157:H7
Q8DY66 1.13e-07 55 24 4 181 3 htpX Protease HtpX homolog Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q3JZQ9 1.13e-07 55 24 4 181 3 htpX Protease HtpX homolog Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q8E3T2 1.16e-07 55 24 4 181 3 htpX Protease HtpX homolog Streptococcus agalactiae serotype III (strain NEM316)
A3CLJ7 1.53e-07 54 24 5 203 3 htpX Protease HtpX homolog Streptococcus sanguinis (strain SK36)
P66950 1.72e-07 55 25 6 186 3 bepA Beta-barrel assembly-enhancing protease Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66951 1.72e-07 55 25 6 186 3 bepA Beta-barrel assembly-enhancing protease Salmonella typhi
P0DD31 2.78e-07 53 23 5 203 3 htpX Protease HtpX homolog Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DD30 2.78e-07 53 23 5 203 3 htpX Protease HtpX homolog Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q48V70 2.83e-07 53 23 5 203 3 htpX Protease HtpX homolog Streptococcus pyogenes serotype M28 (strain MGAS6180)
C5A5K3 3.04e-07 53 25 8 217 3 htpX Protease HtpX homolog Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)
A2RGB7 3.25e-07 53 23 5 203 3 htpX Protease HtpX homolog Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J8D6 3.25e-07 53 23 5 203 3 htpX Protease HtpX homolog Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JII1 3.25e-07 53 23 5 203 3 htpX Protease HtpX homolog Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JND2 3.25e-07 53 23 5 203 3 htpX Protease HtpX homolog Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q8P2K0 3.25e-07 53 23 5 203 3 htpX Protease HtpX homolog Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q9A1D5 3.25e-07 53 23 5 203 3 htpX Protease HtpX homolog Streptococcus pyogenes serotype M1
B5XJV3 3.38e-07 53 23 5 203 3 htpX Protease HtpX homolog Streptococcus pyogenes serotype M49 (strain NZ131)
Q5XDS0 3.54e-07 53 23 5 203 3 htpX Protease HtpX homolog Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q93D93 5.5e-07 53 23 5 205 3 htpX Protease HtpX homolog Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
C0MG49 8e-07 52 22 5 202 3 htpX Protease HtpX homolog Streptococcus equi subsp. zooepidemicus (strain H70)
B4U4T2 8e-07 52 22 5 202 3 htpX Protease HtpX homolog Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
A0LHQ9 1e-06 52 25 10 239 3 htpX Protease HtpX homolog Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q9PA93 1.08e-06 52 29 9 192 2 htpX Protease HtpX Xylella fastidiosa (strain 9a5c)
B8E160 1.63e-06 51 25 7 197 3 htpX Protease HtpX homolog Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
D3ZS74 2.27e-06 51 22 8 217 1 Oma1 Metalloendopeptidase OMA1, mitochondrial Rattus norvegicus
Q5QZ20 3.1e-06 50 29 8 186 3 htpX Protease HtpX Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A7ZCL2 3.45e-06 50 31 5 147 3 htpX Protease HtpX homolog Campylobacter concisus (strain 13826)
Q8DPH5 4.66e-06 50 23 6 205 3 htpX Protease HtpX homolog Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B1IC73 4.66e-06 50 23 6 205 3 htpX Protease HtpX homolog Streptococcus pneumoniae (strain Hungary19A-6)
Q04K41 4.66e-06 50 23 6 205 3 htpX Protease HtpX homolog Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q9KQ40 4.95e-06 50 23 6 197 3 VC_2164 Putative beta-barrel assembly-enhancing protease Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q97QD6 5.11e-06 50 23 6 205 3 htpX Protease HtpX homolog Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
C0M819 5.12e-06 50 21 5 202 3 htpX Protease HtpX homolog Streptococcus equi subsp. equi (strain 4047)
B8FG65 5.69e-06 50 28 7 191 3 htpX Protease HtpX homolog Desulfatibacillum aliphaticivorans
B8GTV4 6.47e-06 49 25 6 187 3 htpX Protease HtpX Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A7GZM4 6.68e-06 49 50 2 50 3 htpX Protease HtpX homolog Campylobacter curvus (strain 525.92)
C1CR23 7.32e-06 49 23 6 205 3 htpX Protease HtpX homolog Streptococcus pneumoniae (strain Taiwan19F-14)
C1CEN8 8.41e-06 49 24 6 204 3 htpX Protease HtpX homolog Streptococcus pneumoniae (strain JJA)
B8ZJU7 8.41e-06 49 24 6 204 3 htpX Protease HtpX homolog Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
C1C7R3 8.41e-06 49 24 6 204 3 htpX Protease HtpX homolog Streptococcus pneumoniae (strain 70585)
B5E520 8.41e-06 49 24 6 204 3 htpX Protease HtpX homolog Streptococcus pneumoniae serotype 19F (strain G54)
E9QBI7 1.27e-05 49 22 7 179 3 oma1 Metalloendopeptidase OMA1, mitochondrial Danio rerio
Q9CBA4 1.29e-05 48 32 2 88 3 htpX Protease HtpX homolog Mycobacterium leprae (strain TN)
B8ZSY8 1.29e-05 48 32 2 88 3 htpX Protease HtpX homolog Mycobacterium leprae (strain Br4923)
C1CL18 1.39e-05 48 24 5 204 3 htpX Protease HtpX homolog Streptococcus pneumoniae (strain P1031)
Q96E52 1.87e-05 48 22 8 188 1 OMA1 Metalloendopeptidase OMA1, mitochondrial Homo sapiens
Q87A36 1.89e-05 48 28 9 192 3 htpX Protease HtpX Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2IA62 1.89e-05 48 28 9 192 3 htpX Protease HtpX Xylella fastidiosa (strain M23)
Q5YPB8 2.61e-05 48 27 9 217 3 htpX Protease HtpX homolog Nocardia farcinica (strain IFM 10152)
C6A335 2.66e-05 48 25 8 224 3 htpX Protease HtpX homolog Thermococcus sibiricus (strain DSM 12597 / MM 739)
B0U5X0 2.91e-05 47 28 8 192 3 htpX Protease HtpX Xylella fastidiosa (strain M12)
A1AZW2 2.94e-05 47 26 8 195 3 htpX Protease HtpX homolog Paracoccus denitrificans (strain Pd 1222)
Q5M0E9 2.98e-05 47 24 6 204 3 htpX Protease HtpX homolog Streptococcus thermophilus (strain CNRZ 1066)
Q5M4Z6 3e-05 47 21 5 208 3 htpX Protease HtpX homolog Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q83IG0 3.07e-05 47 25 7 194 3 htpX Protease HtpX homolog Tropheryma whipplei (strain TW08/27)
Q3SZN3 3.98e-05 47 20 7 183 2 OMA1 Metalloendopeptidase OMA1, mitochondrial Bos taurus
Q8THH5 4.24e-05 47 23 8 276 3 htpX1 Protease HtpX homolog 1 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q03LB2 4.76e-05 47 24 6 204 3 htpX Protease HtpX homolog Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q9HSQ2 5.35e-05 47 38 1 67 3 htpX Protease HtpX homolog Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B1XSN0 7.22e-05 46 23 12 273 3 htpX Protease HtpX homolog Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q04WP4 7.31e-05 46 28 8 180 3 htpX Protease HtpX homolog Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04NG2 7.31e-05 46 28 8 180 3 htpX Protease HtpX homolog Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q9D8H7 8e-05 47 28 4 90 1 Oma1 Metalloendopeptidase OMA1, mitochondrial Mus musculus
Q83H47 8.53e-05 46 24 7 194 3 htpX Protease HtpX homolog Tropheryma whipplei (strain Twist)
B5YKM8 9.33e-05 46 44 2 50 3 htpX Protease HtpX homolog Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
A8YWL7 0.000113 46 24 7 203 3 htpX Protease HtpX homolog Lactobacillus helveticus (strain DPC 4571)
Q9UZK3 0.000125 45 22 6 218 3 htpX Protease HtpX homolog Pyrococcus abyssi (strain GE5 / Orsay)
Q2RKK7 0.00015 45 35 1 74 3 htpX Protease HtpX homolog Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q2S6C2 0.000171 45 24 6 176 3 htpX Protease HtpX homolog Salinibacter ruber (strain DSM 13855 / M31)
A7I0F9 0.000171 45 46 2 49 3 htpX Protease HtpX homolog Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
A8H3J1 0.000176 45 28 8 190 3 htpX Protease HtpX Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A5V7N3 0.000178 45 27 4 140 3 htpX Protease HtpX homolog Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
A8FX04 0.000202 45 27 8 195 3 htpX Protease HtpX Shewanella sediminis (strain HAW-EB3)
P9WHS5 0.000222 45 31 2 88 1 htpX Protease HtpX homolog Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHS4 0.000222 45 31 2 88 3 htpX Protease HtpX homolog Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5TZU3 0.000222 45 31 2 88 3 htpX Protease HtpX homolog Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AKP3 0.000222 45 31 2 88 3 htpX Protease HtpX homolog Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KG40 0.000222 45 31 2 88 3 htpX Protease HtpX homolog Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P65816 0.000222 45 31 2 88 3 htpX Protease HtpX homolog Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
O58997 0.000224 45 22 6 218 3 htpX Protease HtpX homolog Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q98ET0 0.00027 45 25 11 266 3 htpX Protease HtpX homolog Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q5WZY7 0.000285 44 27 10 214 3 htpX Protease HtpX Legionella pneumophila (strain Lens)
Q1BDZ2 0.000306 44 32 2 88 3 htpX Protease HtpX homolog Mycobacterium sp. (strain MCS)
A1UAZ4 0.000306 44 32 2 88 3 htpX Protease HtpX homolog Mycobacterium sp. (strain KMS)
A3PUK0 0.000306 44 32 2 88 3 htpX Protease HtpX homolog Mycobacterium sp. (strain JLS)
Q8PJX8 0.000312 44 27 9 197 3 htpX Protease HtpX Xanthomonas axonopodis pv. citri (strain 306)
P44840 0.000345 44 24 7 190 3 htpX Protease HtpX Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UHK2 0.000345 44 24 7 190 3 htpX Protease HtpX Haemophilus influenzae (strain PittGG)
Q12MB4 0.000366 44 29 9 185 3 htpX Protease HtpX Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q4QMJ9 0.000372 44 24 7 190 3 htpX Protease HtpX Haemophilus influenzae (strain 86-028NP)
A5UE05 0.000379 44 24 7 190 3 htpX Protease HtpX Haemophilus influenzae (strain PittEE)
B2GA61 0.000386 44 21 5 204 3 htpX Protease HtpX homolog Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q9JV19 0.000395 44 42 1 50 3 htpX Protease HtpX homolog Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M3Q1 0.000395 44 42 1 50 3 htpX Protease HtpX homolog Neisseria meningitidis serogroup C (strain 053442)
B4RKA0 0.000395 44 42 1 50 3 htpX Protease HtpX homolog Neisseria gonorrhoeae (strain NCCP11945)
Q5F9J4 0.000395 44 42 1 50 3 htpX Protease HtpX homolog Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A1KT72 0.000398 44 42 1 50 3 htpX Protease HtpX homolog Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9K006 0.000398 44 42 1 50 3 htpX Protease HtpX homolog Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A3QDP2 0.000412 44 29 9 191 3 htpX Protease HtpX Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q5FMS7 0.00053 43 42 1 50 3 htpX Protease HtpX homolog Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q5X8K6 0.000561 43 26 9 210 3 htpX Protease HtpX Legionella pneumophila (strain Paris)
B2HRQ7 0.000572 43 30 2 88 3 htpX Protease HtpX homolog Mycobacterium marinum (strain ATCC BAA-535 / M)
B1MY16 0.000583 43 25 9 201 3 htpX Protease HtpX homolog Leuconostoc citreum (strain KM20)
Q083Z6 0.000623 43 29 9 185 3 htpX Protease HtpX Shewanella frigidimarina (strain NCIMB 400)
A0PLW0 0.000674 43 30 2 88 3 htpX Protease HtpX homolog Mycobacterium ulcerans (strain Agy99)
Q8R936 0.000725 43 21 6 201 3 htpX Protease HtpX homolog Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A5IA60 0.000739 43 26 9 210 3 htpX Protease HtpX Legionella pneumophila (strain Corby)
Q5ZZ31 0.000753 43 26 9 210 3 htpX Protease HtpX Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
B0T658 0.000875 43 23 10 291 3 htpX Protease HtpX homolog Caulobacter sp. (strain K31)
Q03DY7 0.001 43 42 2 50 3 htpX Protease HtpX homolog Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
A2SCF8 0.001 43 40 2 50 3 htpX Protease HtpX homolog Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_09245
Feature type CDS
Gene htpX
Product Zn-dependent protease with chaperone function
Location 183270 - 184022 (strand: -1)
Length 753 (nucleotides) / 250 (amino acids)

Contig

Accession ZDB_365
Length 192330 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2343
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01435 Peptidase family M48

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0501 Posttranslational modification, protein turnover, chaperones (O) O Zn-dependent protease with chaperone function

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07387 metalloprotease [EC:3.4.24.-] - -

Protein Sequence

MKLKTISALAVSAVVLAGCQNMNYDTLAQSGGQLFQAATLTDADMVKLTDGACKEMDAKNNIAPASGKYAARMDKIAKSLGSDVNGTKVNYKVYMTNEPNAWAMANGCVRVYSGLMDIMNDNEIEGVLGHELGHVGLGHTRKAMQVAYAAVAAKTAAGSAGGLASELSNSQFADMGIKLVNAQFSQRQETEADNYSYDLLKKRGISTEGLATGFEKLAKMDKGQNSIFDSHPPTAERAENIRKRIAEDKQ

Flanking regions ( +/- flanking 50bp)

ATTGATACCTTTGCATCCGTAAAAATACTGAGTAAACGGAAGCAGACAGAATGAAATTAAAGACGATCTCAGCCCTTGCGGTATCCGCTGTTGTTCTGGCCGGTTGCCAGAATATGAATTATGACACCCTGGCACAGTCCGGCGGCCAGTTATTTCAGGCTGCCACCTTAACCGATGCGGATATGGTGAAACTGACGGACGGCGCCTGCAAAGAGATGGATGCAAAAAATAACATTGCACCGGCCTCCGGAAAATACGCGGCACGCATGGACAAAATCGCCAAATCATTAGGTTCCGATGTGAACGGCACAAAAGTGAATTACAAGGTCTATATGACCAATGAACCGAATGCCTGGGCGATGGCGAACGGCTGTGTCCGTGTTTACAGCGGTCTGATGGATATCATGAATGATAATGAAATCGAAGGTGTTCTGGGGCATGAATTAGGACACGTCGGCCTGGGTCACACCCGCAAAGCAATGCAGGTTGCCTATGCTGCTGTGGCAGCAAAAACAGCGGCGGGTTCAGCGGGCGGTCTTGCGTCTGAGCTGAGTAATTCTCAGTTTGCCGATATGGGTATCAAACTGGTTAATGCACAGTTCTCGCAGCGTCAGGAAACGGAAGCGGACAATTATTCCTATGATCTGCTGAAAAAACGCGGCATTTCAACGGAAGGTCTGGCTACCGGGTTTGAAAAGCTCGCGAAAATGGATAAAGGGCAGAACAGCATATTTGATTCTCACCCGCCGACCGCAGAGCGCGCAGAGAATATCCGTAAGCGGATAGCGGAAGATAAACAGTAAGTGTTCCGGATAATAAAAAAGGTGGCTGAGCCACCTTTTTTATCAGGACA