Homologs in group_2769

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07790 FBDBKF_07790 100.0 Morganella morganii S1 xdhC xanthine dehydrogenase iron sulfur-binding subunit XdhC
EHELCC_13620 EHELCC_13620 100.0 Morganella morganii S2 xdhC xanthine dehydrogenase iron sulfur-binding subunit XdhC
NLDBIP_14065 NLDBIP_14065 100.0 Morganella morganii S4 xdhC xanthine dehydrogenase iron sulfur-binding subunit XdhC
HKOGLL_08335 HKOGLL_08335 100.0 Morganella morganii S5 xdhC xanthine dehydrogenase iron sulfur-binding subunit XdhC
F4V73_RS13255 F4V73_RS13255 90.6 Morganella psychrotolerans xdhC xanthine dehydrogenase iron sulfur-binding subunit XdhC

Distribution of the homologs in the orthogroup group_2769

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2769

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q46801 6.9e-71 213 68 0 150 3 xdhC Putative xanthine dehydrogenase iron-sulfur-binding subunit XdhC Escherichia coli (strain K12)
Q8X6C4 1.81e-70 212 64 0 159 3 xdhC Xanthine dehydrogenase iron-sulfur-binding subunit Escherichia coli O157:H7
Q0QLF3 2.79e-42 140 52 2 139 1 ndhS Nicotinate dehydrogenase small FeS subunit Eubacterium barkeri
Q4J6M5 2.55e-34 120 44 2 140 1 cutC Glyceraldehyde dehydrogenase small chain Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q59128 9.6e-34 119 45 3 144 1 ndhS Nicotine 6-hydroxylase small subunit Paenarthrobacter nicotinovorans
P19915 4.78e-33 117 41 3 155 1 cutS Carbon monoxide dehydrogenase small chain Hydrogenophaga pseudoflava
D7REY5 5.74e-32 115 44 2 145 1 cdhC Caffeine dehydrogenase subunit gamma Pseudomonas sp. (strain CBB1)
O32143 1.68e-31 114 39 4 166 2 pucE Probable xanthine dehydrogenase subunit E Bacillus subtilis (strain 168)
O33818 6.93e-31 112 47 2 135 1 hcrC 4-hydroxybenzoyl-CoA reductase subunit gamma Thauera aromatica
P19921 1.11e-30 111 42 3 145 1 coxS Carbon monoxide dehydrogenase small chain Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q88FX9 6.7e-29 107 44 2 136 1 nicA Nicotinate dehydrogenase subunit A Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
O87682 2.19e-27 103 38 2 144 1 kdhB 6-hydroxypseudooxynicotine dehydrogenase complex subunit beta Paenarthrobacter nicotinovorans
R4ZGN4 1.6e-23 99 38 4 153 1 AXOR Xanthine dehydrogenase Blastobotrys adeninivorans
Q12553 2.11e-23 99 37 4 164 2 hxA Xanthine dehydrogenase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q46509 2.29e-22 95 40 2 142 1 mop Aldehyde oxidoreductase Megalodesulfovibrio gigas
Q54FB7 4.88e-22 94 36 6 157 3 xdh Xanthine dehydrogenase Dictyostelium discoideum
P77165 3.2e-21 89 33 2 162 1 paoA Aldehyde oxidoreductase iron-sulfur-binding subunit PaoA Escherichia coli (strain K12)
Q8X6I9 4.73e-21 88 34 3 164 3 paoA Aldehyde oxidoreductase iron-sulfur-binding subunit PaoA Escherichia coli O157:H7
Q7G191 1.61e-18 84 35 6 157 1 AAO4 Aldehyde oxidase 4 Arabidopsis thaliana
Q7G192 8.47e-18 82 35 7 158 1 AAO2 Indole-3-acetaldehyde oxidase Arabidopsis thaliana
Q3TYQ9 1.78e-17 81 36 4 128 1 Aox4 Aldehyde oxidase 4 Mus musculus
Q960A1 1.95e-17 81 35 4 151 3 gad-3 Probable aldehyde oxidase gad-3 Caenorhabditis elegans
H9TB19 2.94e-17 81 38 5 149 2 AOX2 Aldehyde oxidase 2 Cavia porcellus
Q51697 4.67e-17 76 38 5 149 1 iorA Isoquinoline 1-oxidoreductase subunit alpha Brevundimonas diminuta
Q5QE78 3.94e-16 77 36 6 150 2 Aox2 Aldehyde oxidase 2 Rattus norvegicus
P10351 1.21e-15 76 36 5 149 2 ry Xanthine dehydrogenase Drosophila melanogaster
C4NYZ3 1.41e-15 76 35 6 151 2 AOX2 Aldehyde oxidase 2 Macaca fascicularis
Q5SGK3 5.03e-15 74 36 6 150 1 Aox2 Aldehyde oxidase 2 Mus musculus
P91711 2.59e-14 72 34 5 149 3 Xdh Xanthine dehydrogenase Drosophila subobscura
P22811 3.66e-14 72 34 5 149 3 ry Xanthine dehydrogenase Drosophila pseudoobscura pseudoobscura
Q8XD64 6.82e-14 71 33 2 139 3 xdhD Probable hypoxanthine oxidase XdhD Escherichia coli O157:H7
Q46814 7.73e-14 71 33 2 139 3 xdhD Probable hypoxanthine oxidase XdhD Escherichia coli (strain K12)
H9TB18 7.75e-14 71 34 3 130 2 AOX4 Aldehyde oxidase 4 Cavia porcellus
Q8GUQ8 6.71e-13 68 41 3 94 1 XDH1 Xanthine dehydrogenase 1 Arabidopsis thaliana
Q6AUV1 1.22e-12 67 40 2 93 2 XDH Xanthine dehydrogenase Oryza sativa subsp. japonica
A0A1U8QNG8 1.62e-12 67 35 5 150 1 hxnS Nicotinate hydroxylase hnxS Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
F4JLI5 2.63e-12 67 40 3 94 2 XDH2 Xanthine dehydrogenase 2 Arabidopsis thaliana
Q7G193 7.15e-12 65 37 7 164 1 AAO1 Indole-3-acetaldehyde oxidase Arabidopsis thaliana
P48034 9.25e-12 65 50 1 62 1 AOX1 Aldehyde oxidase 1 Bos taurus
Q5FB27 4.43e-11 63 39 2 91 2 AOX1 Aldehyde oxidase 1 Macaca fascicularis
Q06278 4.79e-11 63 39 2 91 1 AOX1 Aldehyde oxidase Homo sapiens
O54754 6.57e-11 62 38 2 93 1 Aox1 Aldehyde oxidase 1 Mus musculus
H9TB17 7.96e-11 62 48 1 62 1 AOX1 Aldehyde oxidase 1 Cavia porcellus
P80456 9.74e-11 62 48 1 62 1 AOX1 Aldehyde oxidase 1 Oryctolagus cuniculus
Q7G9P4 1.18e-10 62 33 2 95 1 AAO3 Abscisic-aldehyde oxidase Arabidopsis thaliana
Q9Z0U5 1.24e-10 62 38 2 93 1 Aox1 Aldehyde oxidase 1 Rattus norvegicus
P08793 1.46e-10 62 36 2 94 2 XDH Xanthine dehydrogenase Calliphora vicina
Q00519 1.5e-10 62 38 2 89 1 Xdh Xanthine dehydrogenase/oxidase Mus musculus
Q5QE79 1.56e-10 62 34 4 114 2 Aox4 Aldehyde oxidase 4 Rattus norvegicus
Q5QE80 1.87e-10 61 42 1 69 1 Aox3 Aldehyde oxidase 3 Rattus norvegicus
P22985 2.08e-10 61 37 1 89 1 Xdh Xanthine dehydrogenase/oxidase Rattus norvegicus
G3X982 6.15e-10 60 42 1 66 1 Aox3 Aldehyde oxidase 3 Mus musculus
Q9MYW6 2.27e-09 58 40 1 69 2 XDH Xanthine dehydrogenase/oxidase Felis catus
P80457 3.11e-09 58 44 1 58 1 XDH Xanthine dehydrogenase/oxidase Bos taurus
P47989 4.23e-09 57 44 1 59 1 XDH Xanthine dehydrogenase/oxidase Homo sapiens
Q6Z351 7.66e-09 57 32 6 125 3 Os07g0281700 Putative aldehyde oxidase-like protein Oryza sativa subsp. japonica
O23888 7.66e-09 57 35 4 105 2 AO2 Indole-3-acetaldehyde oxidase Zea mays
Q69R21 6.01e-08 54 31 4 110 2 Os07g0282300 Probable aldehyde oxidase 4 Oryza sativa subsp. japonica
O23887 7.48e-08 53 26 5 171 1 AO1 Indole-3-acetaldehyde oxidase Zea mays
P47990 2.72e-07 52 36 6 150 1 XDH Xanthine dehydrogenase/oxidase Gallus gallus
Q852M1 6.11e-07 51 36 1 73 2 Os03g0790900 Probable aldehyde oxidase 2 Oryza sativa subsp. japonica
Q852M2 6.79e-07 51 35 1 73 2 Os03g0790700 Probable aldehyde oxidase 3 Oryza sativa subsp. japonica
Q7XH05 0.000231 43 32 1 76 2 Os10g0138100 Probable aldehyde oxidase 1 Oryza sativa subsp. japonica

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_08785
Feature type CDS
Gene xdhC
Product xanthine dehydrogenase iron sulfur-binding subunit XdhC
Location 85129 - 85608 (strand: 1)
Length 480 (nucleotides) / 159 (amino acids)

Contig

Accession ZDB_365
Length 192330 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2769
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00111 2Fe-2S iron-sulfur cluster binding domain
PF01799 [2Fe-2S] binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2080 Energy production and conversion (C) C Aldehyde, CO, or xanthine dehydrogenase, Fe-S subunit, CoxS/CutS family

Protein Sequence

MNIKEWKTISCTLNGQVRELTVSPAARLSDVLREQGLISVKHGCSVGECGACTVLIDGIAVDTCLYLAVWADGKQIRTAEGEMKHGKPSAVQQAYADSGAVQCGFCTPGLIMMTTALLEKHKGQTLTIRQIRHGLAGNLCRCTGYQMVANAADKLQRNQ

Flanking regions ( +/- flanking 50bp)

AGCGAGCGGGTGATCCGCACGGCGGCTGAACGTCTGGGAGAAAAAATCGCATGAATATCAAAGAATGGAAAACCATCAGCTGCACACTCAACGGACAGGTACGGGAACTGACGGTGTCACCGGCGGCACGGCTGTCCGATGTCCTGCGTGAGCAGGGGCTTATCAGTGTCAAACACGGCTGTTCTGTCGGCGAGTGCGGTGCCTGCACGGTACTTATCGACGGTATCGCGGTGGATACCTGTCTCTATCTGGCGGTCTGGGCGGACGGTAAGCAGATCCGAACCGCCGAAGGTGAGATGAAGCACGGTAAACCGTCTGCGGTACAGCAGGCTTATGCGGACAGCGGCGCGGTACAGTGCGGGTTCTGCACCCCTGGCCTGATTATGATGACCACCGCCCTGCTGGAAAAACACAAAGGGCAGACCCTGACCATCCGTCAGATCCGCCACGGCCTGGCCGGTAACCTGTGCCGCTGCACCGGTTATCAGATGGTTGCCAATGCCGCGGATAAACTCCAGCGTAATCAGTAAACCGCAGAAAATAGACACCGTCCGTCTTCAGGACGGCGGTGTCAGGGTTG