Homologs in group_724

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03190 FBDBKF_03190 100.0 Morganella morganii S1 ibaG BolA family iron metabolism protein IbaG
EHELCC_07345 EHELCC_07345 100.0 Morganella morganii S2 ibaG BolA family iron metabolism protein IbaG
NLDBIP_07670 NLDBIP_07670 100.0 Morganella morganii S4 ibaG BolA family iron metabolism protein IbaG
HKOGLL_03725 HKOGLL_03725 100.0 Morganella morganii S5 ibaG BolA family iron metabolism protein IbaG
F4V73_RS11730 F4V73_RS11730 96.4 Morganella psychrotolerans ibaG BolA family iron metabolism protein IbaG
PMI_RS18210 PMI_RS18210 81.0 Proteus mirabilis HI4320 ibaG BolA family iron metabolism protein IbaG

Distribution of the homologs in the orthogroup group_724

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_724

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A9W8 1.66e-44 140 75 0 84 3 ibaG Acid stress protein IbaG Shigella flexneri
P0A9W6 1.66e-44 140 75 0 84 1 ibaG Acid stress protein IbaG Escherichia coli (strain K12)
P0A9W7 1.66e-44 140 75 0 84 3 ibaG Acid stress protein IbaG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P45026 1.66e-23 88 47 0 82 1 HI_1082 Uncharacterized protein HI_1082 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8K9G5 1.35e-22 85 40 0 80 3 BUsg_372 Uncharacterized protein BUsg_372 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57465 2.54e-20 79 48 0 80 3 BU385 Uncharacterized protein BU385 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q89AF0 2.36e-19 77 43 0 74 3 bbp_348 Uncharacterized protein bbp_348 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P33989 5.95e-12 58 33 0 77 3 None Uncharacterized protein in rpoN-murA intergenic region Acinetobacter guillouiae
P73055 6.6e-12 58 36 1 79 3 ssr3122 Uncharacterized protein ssr3122 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q86KD0 9.6e-11 56 32 1 87 3 DDB_G0274169 BolA-like protein DDB_G0274169 Dictyostelium discoideum
Q3T138 7.86e-10 54 39 1 63 2 BOLA1 BolA-like protein 1 Bos taurus
Q9D8S9 1.94e-09 53 39 1 63 1 Bola1 BolA-like protein 1 Mus musculus
Q5RCE5 2.53e-09 53 38 1 63 2 BOLA1 BolA-like protein 1 Pongo abelii
Q9Y3E2 2.91e-09 53 38 1 63 1 BOLA1 BolA-like protein 1 Homo sapiens
O14280 1.14e-08 50 46 1 54 3 SPAC8C9.11 Uncharacterized bolA-like protein C8C9.11 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q56585 3.08e-07 47 38 1 60 3 bolA DNA-binding transcriptional regulator BolA Vibrio alginolyticus
P0ABE4 7.04e-06 43 33 1 57 3 bolA DNA-binding transcriptional regulator BolA Shigella flexneri
P0ABE2 7.04e-06 43 33 1 57 1 bolA DNA-binding transcriptional regulator BolA Escherichia coli (strain K12)
P0ABE3 7.04e-06 43 33 1 57 3 bolA DNA-binding transcriptional regulator BolA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P53082 1.75e-05 43 34 1 55 1 BOL2 BolA-like protein 2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9KPS0 2.35e-05 42 36 1 58 3 bolA DNA-binding transcriptional regulator BolA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P43780 2.85e-05 42 33 1 54 3 bolA DNA-binding transcriptional regulator BolA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9FIC3 3.02e-05 42 43 2 57 1 BOLA2 Protein BOLA2 Arabidopsis thaliana
Q682I1 7.99e-05 42 43 1 53 1 BOLA1 Protein BOLA1, chloroplastic Arabidopsis thaliana

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_07205
Feature type CDS
Gene ibaG
Product BolA family iron metabolism protein IbaG
Location 168149 - 168403 (strand: 1)
Length 255 (nucleotides) / 84 (amino acids)

Contig

Accession ZDB_363
Length 233386 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_724
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01722 BolA-like protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG5007 Signal transduction mechanisms (T) T Acid stress protein IbaG/YrbA, BolA-like family

Protein Sequence

MDTNEIKQVLMDKLALTDAIVTGDGSHFQVIAVGDLFDGMSRVKQQQAVYAPLMEYIADNRIHALSIKAYTPAQWERDRKLSGL

Flanking regions ( +/- flanking 50bp)

GATTACGATAGTGCCTATAACACACAATCTGATAACCAATTTGAGAAATTATGGATACGAATGAAATCAAACAGGTGCTGATGGATAAGTTAGCACTTACTGACGCAATTGTGACCGGTGACGGCAGCCATTTTCAGGTGATCGCCGTCGGCGATCTTTTTGACGGCATGAGCCGTGTTAAACAGCAGCAGGCCGTGTATGCGCCGCTGATGGAATATATTGCGGATAACCGTATCCACGCGTTGTCTATCAAAGCCTATACCCCGGCTCAGTGGGAACGGGATCGTAAACTGAGCGGGCTGTAACCGCGGCGGCTGACAATGCAGTGACAAGTAACGCGGCAGCAATTAATGAT