Homologs in group_3430

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14430 FBDBKF_14430 100.0 Morganella morganii S1 - YqaE/Pmp3 family membrane protein
EHELCC_07850 EHELCC_07850 100.0 Morganella morganii S2 - YqaE/Pmp3 family membrane protein
NLDBIP_08175 NLDBIP_08175 100.0 Morganella morganii S4 - YqaE/Pmp3 family membrane protein
HKOGLL_04825 HKOGLL_04825 100.0 Morganella morganii S5 - YqaE/Pmp3 family membrane protein

Distribution of the homologs in the orthogroup group_3430

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3430

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_06090
Feature type CDS
Gene -
Product YqaE/Pmp3 family membrane protein
Location 225386 - 225541 (strand: -1)
Length 156 (nucleotides) / 51 (amino acids)

Contig

Accession ZDB_362
Length 257361 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3430
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MPFILLWIGLALLLGFIASGSGRSFWAWFVLGVVIDPILAGLLYLLIARDA

Flanking regions ( +/- flanking 50bp)

CTTGTTATTTTTTGTCATTAATAATGATTTTTTCATAAGGGAATTTATTTATGCCATTTATTCTGCTTTGGATTGGGCTTGCATTGTTGCTGGGTTTTATCGCTTCAGGTAGTGGACGTTCATTCTGGGCTTGGTTTGTTCTGGGTGTTGTTATTGATCCTATACTGGCTGGGTTACTGTATTTATTAATAGCCCGGGATGCCTGACCATGTTTAAAGAATTTATAAAAAGACAGCTTGTTATCATTTTTAAATGG