Homologs in group_2197

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16555 FBDBKF_16555 100.0 Morganella morganii S1 uraA uracil permease
EHELCC_08420 EHELCC_08420 100.0 Morganella morganii S2 uraA uracil permease
NLDBIP_08745 NLDBIP_08745 100.0 Morganella morganii S4 uraA uracil permease
HKOGLL_05395 HKOGLL_05395 100.0 Morganella morganii S5 uraA uracil permease
F4V73_RS03075 F4V73_RS03075 96.3 Morganella psychrotolerans uraA uracil permease
PMI_RS07665 PMI_RS07665 85.1 Proteus mirabilis HI4320 uraA uracil permease

Distribution of the homologs in the orthogroup group_2197

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2197

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AGM7 0.0 699 81 0 429 1 uraA Uracil permease Escherichia coli (strain K12)
P0AGM8 0.0 699 81 0 429 1 uraA Uracil permease Escherichia coli O157:H7
A0A2A5K1W4 4.41e-180 511 63 2 417 1 PL1_0655 Uracil permease Paenibacillus larvae subsp. larvae (strain NRRL B-3650 / LMG 16245)
P41006 1.07e-111 338 45 7 438 3 pyrP Uracil permease Bacillus caldolyticus
P39766 3.73e-109 331 43 7 443 1 pyrP Uracil permease Bacillus subtilis (strain 168)
P75892 3.83e-78 252 38 6 427 1 rutG Putative pyrimidine permease RutG Escherichia coli (strain K12)
Q9CPL9 5.35e-75 243 36 6 417 3 uraA Probable uracil permease Pasteurella multocida (strain Pm70)
P45117 1.67e-70 231 36 2 385 3 uraA Probable uracil permease Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O32140 1.81e-37 144 30 11 407 2 pucK Uric acid permease PucK Bacillus subtilis (strain 168)
P50487 2.74e-35 139 31 12 393 3 cpx Putative purine permease CPE0397 Clostridium perfringens (strain 13 / Type A)
A0A2A5JY22 3.26e-34 135 29 10 386 1 PL1_3014 Nucleobase transporter PlUacP Paenibacillus larvae subsp. larvae (strain NRRL B-3650 / LMG 16245)
Q46821 7.35e-33 132 27 11 411 1 uacT Uric acid transporter UacT Escherichia coli (strain K12)
P42086 1.22e-28 120 28 12 375 3 pbuX Xanthine permease Bacillus subtilis (strain 168)
O32139 1.84e-26 114 32 13 386 2 pucJ Uric acid permease PucJ Bacillus subtilis (strain 168)
B0JZG0 3.97e-20 96 27 19 506 2 slc23a2 Solute carrier family 23 member 2 Xenopus tropicalis
P0AGN2 4.07e-20 95 24 17 459 3 xanP Xanthine permease XanP Shigella flexneri
P0AGM9 4.07e-20 95 24 17 459 1 xanP Xanthine permease XanP Escherichia coli (strain K12)
P0AGN0 4.07e-20 95 24 17 459 3 xanP Xanthine permease XanP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AGN1 4.07e-20 95 24 17 459 3 xanP Xanthine permease XanP Escherichia coli O157:H7
Q9EPR4 8.83e-19 92 26 18 506 1 Slc23a2 Solute carrier family 23 member 2 Mus musculus
Q9UGH3 1.5e-18 91 26 18 508 1 SLC23A2 Solute carrier family 23 member 2 Homo sapiens
Q9WTW8 2.28e-18 91 26 18 506 1 Slc23a2 Solute carrier family 23 member 2 Rattus norvegicus
Q9UHI7 8.9e-17 86 24 16 500 1 SLC23A1 Solute carrier family 23 member 1 Homo sapiens
Q9Z2J0 1.16e-15 82 24 17 502 1 Slc23a1 Solute carrier family 23 member 1 Mus musculus
Q9WTW7 4.09e-15 80 24 16 500 2 Slc23a1 Solute carrier family 23 member 1 Rattus norvegicus
P48777 5.84e-15 80 25 11 318 2 uapC Purine permease Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q9SHZ3 1.35e-14 79 25 15 422 2 NAT1 Nucleobase-ascorbate transporter 1 Arabidopsis thaliana
Q07307 8.08e-13 73 24 11 316 1 uapA Uric acid-xanthine permease Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q8VZQ5 1.17e-12 73 26 14 394 2 NAT8 Nucleobase-ascorbate transporter 8 Arabidopsis thaliana
P67444 1.32e-11 69 24 10 372 1 xanQ Xanthine permease XanQ Escherichia coli (strain K12)
P67445 1.32e-11 69 24 10 372 3 xanQ Xanthine permease XanQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P67446 1.32e-11 69 24 10 372 3 xanQ Xanthine permease XanQ Escherichia coli O157:H7
Q94C70 2.25e-11 69 23 13 421 2 NAT2 Nucleobase-ascorbate transporter 2 Arabidopsis thaliana
Q8GZD4 2.73e-11 68 28 3 189 2 NAT3 Nucleobase-ascorbate transporter 3 Arabidopsis thaliana
Q9HE12 3.35e-11 68 23 9 317 3 SPAC1399.01c Putative purine permease C1399.01c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q27GI3 3.71e-11 68 25 14 388 2 NAT6 Nucleobase-ascorbate transporter 6 Arabidopsis thaliana
Q0WPE9 1.39e-08 60 24 13 387 2 NAT7 Nucleobase-ascorbate transporter 7 Arabidopsis thaliana
Q41760 1.49e-08 60 24 11 409 1 LPE1 Nucleobase-ascorbate transporter LPE1 Zea mays
P93039 2.45e-08 59 25 3 176 2 NAT4 Nucleobase-ascorbate transporter 4 Arabidopsis thaliana
Q6SZ87 2.75e-08 59 23 12 430 2 NAT11 Nucleobase-ascorbate transporter 11 Arabidopsis thaliana
Q8RWE9 4.32e-08 58 24 3 176 2 NAT5 Nucleobase-ascorbate transporter 5 Arabidopsis thaliana
O04472 9.81e-06 51 25 2 151 3 NAT10 Putative nucleobase-ascorbate transporter 10 Arabidopsis thaliana
Q3E956 0.000244 47 33 0 66 3 NAT9 Putative nucleobase-ascorbate transporter 9 Arabidopsis thaliana

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_05520
Feature type CDS
Gene uraA
Product uracil permease
Location 98683 - 99972 (strand: -1)
Length 1290 (nucleotides) / 429 (amino acids)

Contig

Accession ZDB_362
Length 257361 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2197
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00860 Permease family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2233 Nucleotide transport and metabolism (F) F Xanthine/uracil permease

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02824 uracil permease - -

Protein Sequence

MTRRVIEVDERPPLLVTIPLSLQHLFAMFGATVLVPILFQVNPATILLFNGIGTLLYLFICKGKIPAYLGSSFAFISPVLILLPLGYELALGGFIICGLLFMLVAGIVKIAGRGWINVLFPPAAMGAIVAVIGLELAGTAAGMAGLKIADGASPDSTTLIISLTTLGVTILGSVVFRGFLAIIPILIGVLTGYALAFFMGAVDLTPVSEAPWFALPTFYTPRFEWFAILTILPAALVVIAEHVGHLVVTANIVKRDLMKDPGLHRSMFANGFSTVLSGFFGSTPNTTYGENIGVMAITKVYSSWVIGGAAVLAILLSCVGKLAAAIAAVPVPVMGGVSLLLYGVIGASGIRVLIDSKVDYNKPQNLILTAVILIIGVSGATIHIGAAELKGMALATVVGIGLALVFRLVNIIRPEERVVDVNLDEVKKD

Flanking regions ( +/- flanking 50bp)

AGTCGGCTTTTTTTTGGCATATCCCTGAGTAATCATTTAAGAGGTTTAAGATGACGCGCCGCGTTATTGAAGTCGATGAACGCCCACCACTGCTGGTCACCATTCCGTTAAGTTTACAGCACCTGTTTGCGATGTTCGGTGCTACCGTTCTGGTGCCGATCCTGTTTCAGGTAAACCCGGCCACGATCCTGTTATTTAACGGTATCGGGACGCTGCTGTATCTGTTTATCTGTAAAGGAAAAATCCCGGCGTACCTGGGCTCAAGCTTTGCCTTTATTTCACCGGTGCTGATTTTACTGCCGCTCGGGTATGAACTCGCTCTCGGCGGGTTTATCATCTGCGGGCTGCTGTTTATGCTGGTGGCGGGGATTGTCAAAATCGCCGGACGCGGCTGGATCAACGTGCTGTTCCCGCCTGCGGCCATGGGTGCGATTGTGGCGGTCATCGGTCTTGAACTGGCAGGAACCGCTGCCGGTATGGCCGGGCTGAAAATCGCGGATGGTGCGTCTCCGGACAGTACCACGCTGATTATCTCCCTGACCACTCTCGGGGTGACGATTCTCGGCTCTGTGGTGTTCCGCGGCTTCCTGGCGATTATTCCGATCCTTATCGGAGTACTGACCGGGTATGCGCTGGCCTTCTTTATGGGCGCGGTAGATTTAACCCCGGTGAGTGAAGCGCCGTGGTTTGCACTGCCGACGTTCTATACGCCGCGCTTTGAGTGGTTTGCTATTCTGACTATCTTGCCGGCAGCGCTGGTCGTGATTGCCGAGCACGTTGGTCATCTTGTGGTCACCGCGAATATTGTCAAACGTGATCTGATGAAAGATCCCGGTCTGCACCGTTCGATGTTTGCCAACGGTTTCTCGACCGTACTGTCCGGCTTCTTCGGCTCCACACCGAACACCACCTATGGTGAAAATATCGGCGTAATGGCGATAACCAAAGTGTACAGTTCCTGGGTTATCGGCGGGGCGGCGGTACTGGCGATTCTGCTCTCCTGTGTCGGTAAACTGGCTGCCGCCATTGCTGCTGTGCCGGTACCGGTGATGGGCGGGGTATCGCTGCTGTTGTACGGGGTTATCGGTGCATCCGGTATCCGCGTGCTGATTGATTCCAAAGTGGATTATAACAAGCCGCAGAACCTGATCCTGACGGCGGTTATCCTGATTATCGGTGTCAGTGGTGCGACCATTCATATCGGTGCGGCTGAACTGAAAGGGATGGCACTGGCAACGGTTGTCGGCATTGGTCTGGCACTGGTGTTCCGTCTGGTGAATATTATCCGTCCGGAAGAGCGGGTAGTGGATGTGAATCTGGATGAAGTGAAGAAAGACTGATTCTGATAGCAGAAAAAAGCCGCAGTGACTGATGAGCCCGTAAAGCCGGG