Homologs in group_1834

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13350 FBDBKF_13350 100.0 Morganella morganii S1 arnF 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF
EHELCC_08745 EHELCC_08745 100.0 Morganella morganii S2 arnF 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF
NLDBIP_09070 NLDBIP_09070 100.0 Morganella morganii S4 arnF 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF
HKOGLL_05720 HKOGLL_05720 100.0 Morganella morganii S5 arnF 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF
F4V73_RS03410 F4V73_RS03410 86.2 Morganella psychrotolerans arnF 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF
PMI_RS05100 PMI_RS05100 61.5 Proteus mirabilis HI4320 arnF 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF

Distribution of the homologs in the orthogroup group_1834

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1834

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4ETM1 3.86e-51 161 62 0 129 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Proteus mirabilis (strain HI4320)
Q7N3R1 4.4e-48 153 62 0 126 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8GDS1 3.94e-39 130 52 1 127 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Serratia proteamaculans (strain 568)
A1JPL6 1.03e-34 119 50 1 125 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JJ34 2.82e-34 118 50 1 130 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q93PD4 2.82e-34 118 50 1 130 2 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TIM8 2.82e-34 118 50 1 130 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Yersinia pestis (strain Pestoides F)
Q1CII1 2.82e-34 118 50 1 130 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Yersinia pestis bv. Antiqua (strain Nepal516)
A9R089 2.82e-34 118 50 1 130 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Yersinia pestis bv. Antiqua (strain Angola)
Q8ZDY0 2.82e-34 118 50 1 130 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Yersinia pestis
B2K5K9 2.82e-34 118 50 1 130 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C746 2.82e-34 118 50 1 130 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Yersinia pestis bv. Antiqua (strain Antiqua)
A7FHH8 2.82e-34 118 50 1 130 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q6D2F5 4.73e-33 115 47 2 126 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A0KGY2 4.09e-30 108 48 3 131 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q3KCB7 3.95e-29 105 47 2 128 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Pseudomonas fluorescens (strain Pf0-1)
A4SQX3 6.88e-28 103 50 2 125 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Aeromonas salmonicida (strain A449)
Q4KC78 3e-24 93 44 2 129 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q48HY7 5.16e-24 92 43 2 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q2NRW1 3.39e-22 87 47 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Sodalis glossinidius (strain morsitans)
Q4ZSY8 4.15e-22 88 40 2 128 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Pseudomonas syringae pv. syringae (strain B728a)
A8FRQ8 1.3e-21 87 45 2 135 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Shewanella sediminis (strain HAW-EB3)
A4WAL9 7.92e-21 84 42 3 132 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Enterobacter sp. (strain 638)
B2VBI5 6.02e-18 77 52 2 121 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q02R29 4.56e-16 72 42 2 108 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Pseudomonas aeruginosa (strain UCBPP-PA14)
B4TBH0 2.62e-14 67 40 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Salmonella heidelberg (strain SL476)
B5RCC8 2.62e-14 67 40 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R276 2.62e-14 67 40 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Salmonella enteritidis PT4 (strain P125109)
B5FPE2 2.62e-14 67 40 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Salmonella dublin (strain CT_02021853)
B5EZI2 2.62e-14 67 40 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Salmonella agona (strain SL483)
Q9HY59 3.52e-14 67 44 2 108 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8ZNF0 5.04e-14 67 40 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TPI6 5.04e-14 67 40 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Salmonella schwarzengrund (strain CVM19633)
C0Q065 5.04e-14 67 40 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Salmonella paratyphi C (strain RKS4594)
A9N5A8 5.04e-14 67 40 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SYX5 5.04e-14 67 40 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Salmonella newport (strain SL254)
Q57M52 5.04e-14 67 40 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Salmonella choleraesuis (strain SC-B67)
A6V1N6 8.11e-14 66 44 2 107 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Pseudomonas aeruginosa (strain PA7)
B7VBM8 8.47e-14 66 43 2 108 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Pseudomonas aeruginosa (strain LESB58)
Q8Z537 1.28e-13 65 40 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Salmonella typhi
B5BCP2 1.28e-13 65 40 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Salmonella paratyphi A (strain AKU_12601)
Q5PNB0 1.28e-13 65 40 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B7LM72 4.81e-13 64 38 2 121 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B5XTL3 1.93e-12 62 40 2 121 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Klebsiella pneumoniae (strain 342)
A6TF94 4.37e-11 59 42 2 121 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B7N5M4 1.95e-08 52 37 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B1LLL3 2.26e-08 52 37 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Escherichia coli (strain SMS-3-5 / SECEC)
Q8FFL7 2.26e-08 52 37 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TFI3 2.26e-08 52 37 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MXU1 2.26e-08 52 37 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Escherichia coli O81 (strain ED1a)
B7NNT8 2.26e-08 52 37 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7UFS1 2.26e-08 52 37 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q1R9F6 3.55e-08 51 36 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Escherichia coli (strain UTI89 / UPEC)
A1ADB0 3.55e-08 51 36 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Escherichia coli O1:K1 / APEC
B7MG26 3.55e-08 51 36 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Escherichia coli O45:K1 (strain S88 / ExPEC)
Q3YZU8 1.16e-07 50 36 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Shigella sonnei (strain Ss046)
P76474 1.16e-07 50 36 1 120 1 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Escherichia coli (strain K12)
B1X8X2 1.16e-07 50 36 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Escherichia coli (strain K12 / DH10B)
Q32DT0 1.28e-07 50 36 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Shigella dysenteriae serotype 1 (strain Sd197)
B7M5U1 1.37e-07 50 36 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Escherichia coli O8 (strain IAI1)
B7LAS4 1.37e-07 50 36 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Escherichia coli (strain 55989 / EAEC)
Q31YJ9 1.57e-07 50 36 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Shigella boydii serotype 4 (strain Sb227)
B6I7K2 1.57e-07 50 36 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Escherichia coli (strain SE11)
B5YXQ2 1.57e-07 50 36 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XDY7 1.57e-07 50 36 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Escherichia coli O157:H7
A7ZP77 1.57e-07 50 36 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Escherichia coli O139:H28 (strain E24377A / ETEC)
B1IXS8 1.65e-07 50 36 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A2C6 1.65e-07 50 36 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Escherichia coli O9:H4 (strain HS)
Q0T2M4 2.71e-07 49 36 1 120 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Shigella flexneri serotype 5b (strain 8401)
A9MJC2 6.38e-07 48 40 1 85 3 arnF Putative 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q83KB5 7.41e-07 48 36 1 118 3 arnF Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Shigella flexneri
B2VBI6 1.16e-05 44 38 1 63 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q1R9F7 3.25e-05 43 41 1 62 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli (strain UTI89 / UPEC)
Q8FFL8 3.25e-05 43 41 1 62 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TFI4 3.25e-05 43 41 1 62 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P0CB28 3.25e-05 43 41 1 62 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli O1:K1 / APEC
B7MG25 3.25e-05 43 41 1 62 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UFS0 3.25e-05 43 41 1 62 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q3KCB8 5.41e-05 43 34 1 64 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Pseudomonas fluorescens (strain Pf0-1)
B7MXU0 5.47e-05 42 41 1 62 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli O81 (strain ED1a)
B7LM73 0.000133 42 40 1 62 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q0T2M5 0.000152 41 38 1 70 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Shigella flexneri serotype 5b (strain 8401)
B5YXQ1 0.00025 41 40 1 62 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X4J8 0.00025 41 40 1 62 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli O157:H7
B7LAS3 0.00025 41 40 1 62 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli (strain 55989 / EAEC)
P0CB31 0.000263 41 40 1 62 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Shigella sonnei (strain Ss046)
P0CB29 0.000263 41 40 1 62 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Shigella boydii serotype 4 (strain Sb227)
B2TW41 0.000263 41 40 1 62 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1LLL2 0.000263 41 40 1 62 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli (strain SMS-3-5 / SECEC)
B6I7K1 0.000263 41 40 1 62 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli (strain SE11)
B7N5M3 0.000263 41 40 1 62 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q47377 0.000263 41 40 1 62 1 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli (strain K12)
B1IXS9 0.000263 41 40 1 62 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A2C5 0.000263 41 40 1 62 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli O9:H4 (strain HS)
B1X8X1 0.000263 41 40 1 62 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli (strain K12 / DH10B)
B7M5U0 0.000263 41 40 1 62 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli O8 (strain IAI1)
B7NNT7 0.000263 41 40 1 62 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A7ZP76 0.000263 41 40 1 62 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Escherichia coli O139:H28 (strain E24377A / ETEC)
P0CB30 0.000705 40 38 1 62 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Shigella dysenteriae serotype 1 (strain Sd197)
Q7UC61 0.000766 40 38 1 62 3 arnE Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Shigella flexneri

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_05195
Feature type CDS
Gene arnF
Product 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF
Location 29695 - 30087 (strand: -1)
Length 393 (nucleotides) / 130 (amino acids)
In genomic island -

Contig

Accession ZDB_362
Length 257361 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1834
Orthogroup size 7
N. genomes 7

Actions

Genomic region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2076 Defense mechanisms (V) V Multidrug transporter EmrE and related cation transporters

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K12963 undecaprenyl phosphate-alpha-L-ara4N flippase subunit ArnF Cationic antimicrobial peptide (CAMP) resistance -

Protein Sequence

MRGYLWVLGSVLFVTAAQLLLKLGVTQLPDIALSSQWLDIRWLLSQWQPFAVVFAGLAGYVLSMVCWLLALRDLPLNKAYPLISLSYVFVYLLAAFLPWFNEGVSLIKSIGIIFILFGVRLIHSKEKPAA

Flanking regions ( +/- flanking 50bp)

GGCGTGGCAGCAATTGTCACCGGCGTGATTCTGATGGGAGCGGGACACTGATGCGCGGATATCTCTGGGTGCTCGGCAGTGTGCTGTTTGTCACCGCCGCTCAGTTGCTGCTGAAACTGGGCGTGACACAATTACCCGATATTGCACTGAGTTCACAATGGCTGGATATCCGCTGGCTGTTATCTCAGTGGCAGCCGTTTGCAGTCGTTTTCGCCGGATTGGCGGGGTATGTTCTGTCAATGGTGTGCTGGCTGCTCGCACTGCGGGATTTGCCGCTCAATAAAGCCTATCCGCTTATCAGCCTGAGTTATGTGTTTGTCTATCTGCTGGCTGCCTTCCTGCCCTGGTTTAATGAAGGTGTGTCGCTGATAAAGAGCATCGGTATTATTTTTATTCTGTTTGGTGTGCGTCTGATCCACAGCAAAGAGAAGCCGGCCGCATAGTCACGGGGCGGTTTACTGTTTTATTAAGCCGCCATTAACCGTTAAGCCTG