Homologs in group_485

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00800 FBDBKF_00800 100.0 Morganella morganii S1 motB flagellar motor protein MotB
EHELCC_00745 EHELCC_00745 100.0 Morganella morganii S2 motB flagellar motor protein MotB
NLDBIP_02715 NLDBIP_02715 100.0 Morganella morganii S4 motB flagellar motor protein MotB
HKOGLL_02815 HKOGLL_02815 100.0 Morganella morganii S5 motB flagellar motor protein MotB
F4V73_RS06800 F4V73_RS06800 83.6 Morganella psychrotolerans motB flagellar motor protein MotB
PMI_RS08150 PMI_RS08150 60.7 Proteus mirabilis HI4320 motB flagellar motor protein MotB

Distribution of the homologs in the orthogroup group_485

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_485

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P55892 3.72e-114 336 59 3 285 1 motB Motility protein B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AF06 3.02e-113 333 56 5 304 1 motB Motility protein B Escherichia coli (strain K12)
P0AF07 3.02e-113 333 56 5 304 3 motB Motility protein B Escherichia coli O157:H7
Q03478 1.87e-40 147 31 9 305 2 lafU Chemotaxis protein LafU Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
D3GSC3 1.56e-39 144 31 6 275 3 lafU Putative flagellar export/assembly protein LafU Escherichia coli O44:H18 (strain 042 / EAEC)
Q47154 3.13e-26 106 38 2 144 5 lafU Putative truncated flagellar export/assembly protein LafU Escherichia coli (strain K12)
P39064 6.46e-12 67 24 8 258 3 ytxE Uncharacterized protein YtxE Bacillus subtilis (strain 168)
O07887 1.95e-08 57 29 15 267 3 motB Motility protein B Treponema pallidum (strain Nichols)
P28612 9.83e-08 55 26 10 253 1 motB Motility protein B Bacillus subtilis (strain 168)
P46827 5.37e-07 53 22 8 242 3 ytxE Uncharacterized 24.6 kDa protein in ccpA 3'region Priestia megaterium
P56427 3.73e-06 51 22 4 215 1 motB Motility protein B Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZL29 7.27e-05 47 21 4 215 3 motB Motility protein B Helicobacter pylori (strain J99 / ATCC 700824)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_04230
Feature type CDS
Gene motB
Product flagellar motor protein MotB
Location 126070 - 127071 (strand: -1)
Length 1002 (nucleotides) / 333 (amino acids)

Contig

Accession ZDB_361
Length 286024 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_485
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00691 OmpA family
PF13677 Membrane MotB of proton-channel complex MotA/MotB

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1360 Cell motility (N) N Flagellar motor protein MotB

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02557 chemotaxis protein MotB Bacterial chemotaxis
Flagellar assembly
-

Protein Sequence

MKPGNTHVIRVKKRGGHGHGGGHGGSWKIAYADFMTAMMAFFLVMWLISISSPQELTQIAEYFRTPLKTAINPGTKTGDATNPIPGGGKDIIYKDGDTLPDPDSMQEEQGQDEAGRFEKLKQDLEQAILKDPRLNELKPHLLIDTTDDGLRIQIVDSANRPMFMVGSTHVEPYMRDILRAIAPILNDVPNRISISGHTDDLPYANGGNYSNWELSAERANASRRELVRGGMAENKILRVVGMASSIHLDKNDGLAPVNRRISIIVLNESEMANILHEYEGAVPITDLQQLKQLPAPHTETPAPPEIPPERVPEPAAPDQTPPQNSAAAADTTQ

Flanking regions ( +/- flanking 50bp)

AGTAAAAGTCAGCCACCGTACCGAAGCACAGGACGGGGAGTAAACCGACGATGAAACCGGGCAATACGCATGTTATCCGCGTCAAAAAGCGGGGCGGTCACGGGCACGGCGGCGGACACGGCGGGTCATGGAAGATTGCTTACGCTGACTTTATGACCGCCATGATGGCGTTCTTCCTGGTGATGTGGCTGATTTCTATCTCCAGCCCGCAGGAGCTGACTCAGATTGCGGAATACTTCCGCACGCCGCTGAAAACAGCGATCAACCCGGGAACAAAAACCGGGGATGCCACTAACCCGATTCCGGGCGGCGGCAAAGACATCATTTACAAAGACGGTGACACACTGCCGGACCCGGACAGCATGCAGGAAGAGCAGGGGCAGGATGAAGCCGGTCGTTTTGAGAAACTGAAACAGGATCTGGAGCAGGCGATTCTCAAAGACCCGCGTCTGAATGAACTGAAGCCGCATCTGCTGATTGATACCACAGATGACGGGCTGCGGATCCAGATTGTCGACAGTGCCAACCGCCCGATGTTTATGGTCGGATCCACTCATGTTGAGCCGTATATGCGGGACATTCTGCGGGCTATCGCGCCGATCCTCAATGACGTGCCGAACCGCATCAGTATTTCCGGTCACACGGATGACCTGCCGTATGCCAACGGCGGTAATTACAGCAACTGGGAACTGTCTGCCGAACGCGCCAATGCCTCGCGCCGTGAACTGGTGCGCGGTGGTATGGCCGAGAACAAAATTCTGCGGGTGGTCGGGATGGCATCCTCTATCCATCTGGATAAAAACGACGGACTTGCGCCGGTGAACCGCCGTATCAGCATCATTGTTCTGAATGAGTCGGAGATGGCAAATATTCTCCATGAATATGAGGGTGCTGTTCCCATTACCGATTTACAGCAGCTGAAGCAGTTACCGGCGCCGCATACAGAGACACCGGCTCCGCCGGAGATCCCGCCGGAAAGGGTGCCGGAACCGGCGGCACCGGATCAGACACCGCCGCAGAACAGCGCTGCGGCGGCAGATACAACACAATAAACAGGATGGACAGGTACTGCCGGATTGCCGGCAGTACCTGTCAGCCGTAA