Homologs in group_483

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00790 FBDBKF_00790 100.0 Morganella morganii S1 cheW chemotaxis protein CheW
EHELCC_00755 EHELCC_00755 100.0 Morganella morganii S2 cheW chemotaxis protein CheW
NLDBIP_02705 NLDBIP_02705 100.0 Morganella morganii S4 cheW chemotaxis protein CheW
HKOGLL_02825 HKOGLL_02825 100.0 Morganella morganii S5 cheW chemotaxis protein CheW
F4V73_RS06790 F4V73_RS06790 97.0 Morganella psychrotolerans cheW chemotaxis protein CheW
PMI_RS08140 PMI_RS08140 77.3 Proteus mirabilis HI4320 cheW chemotaxis protein CheW

Distribution of the homologs in the orthogroup group_483

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_483

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A967 3.77e-83 245 76 0 159 3 cheW Chemotaxis protein CheW Shigella flexneri
P0A964 3.77e-83 245 76 0 159 1 cheW Chemotaxis protein CheW Escherichia coli (strain K12)
P0A965 3.77e-83 245 76 0 159 3 cheW Chemotaxis protein CheW Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A966 3.77e-83 245 76 0 159 3 cheW Chemotaxis protein CheW Escherichia coli O157:H7
P21821 5.97e-83 244 76 0 158 4 cheW Chemotaxis protein CheW Klebsiella aerogenes (strain ATCC 13048 / DSM 30053 / CCUG 1429 / JCM 1235 / KCTC 2190 / NBRC 13534 / NCIMB 10102 / NCTC 10006 / CDC 819-56)
P06110 1.04e-79 236 74 0 158 1 cheW Chemotaxis protein CheW Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q2KCI0 9.42e-31 112 35 1 156 3 cheW Probable chemotaxis protein CheW Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q52881 4.53e-30 110 36 1 149 3 cheW Chemotaxis protein CheW Rhizobium meliloti (strain 1021)
O87715 2.8e-29 108 36 0 134 3 cheW Chemotaxis protein CheW Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q60251 4.47e-22 89 33 1 145 3 cheW Chemotaxis protein CheW Cereibacter sphaeroides
O83453 1.73e-20 85 33 1 139 3 cheW Chemotaxis protein CheW Treponema pallidum (strain Nichols)
O25152 2.68e-19 82 31 1 136 1 cheW Chemotaxis protein CheW Helicobacter pylori (strain ATCC 700392 / 26695)
P39802 7.28e-18 79 29 0 141 1 cheW Chemotaxis protein CheW Bacillus subtilis (strain 168)
P37599 2.36e-07 52 29 2 130 1 cheV Chemotaxis protein CheV Bacillus subtilis (strain 168)
O25154 3.54e-05 46 28 4 127 3 cheV3 Chemotaxis protein CheV3 Helicobacter pylori (strain ATCC 700392 / 26695)
P43498 4.32e-05 45 26 0 118 4 frzA Protein FrzA Myxococcus xanthus
Q56311 7.05e-05 44 27 4 139 1 cheW Chemotaxis protein CheW Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_04220
Feature type CDS
Gene cheW
Product chemotaxis protein CheW
Location 123407 - 123904 (strand: -1)
Length 498 (nucleotides) / 165 (amino acids)

Contig

Accession ZDB_361
Length 286024 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_483
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01584 CheW-like domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0835 Signal transduction mechanisms (T) T Chemotaxis signal transduction protein CheW

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03408 purine-binding chemotaxis protein CheW Two-component system
Bacterial chemotaxis		 -

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG043093 chemotaxis protein CheW VF1154 Motility

Protein Sequence

MSMMDEDLNKLDEEKNGEGYLIFTLGEEEYGIEILKVQEIRGYEQVTRIANTPDFIKGVTNLRGVIIPIIDLRVKFSHQNVTYNDNTVVIVVNLKDRVVGIVVDGVSDVLVLKDEQIAPAPDFAVTLSTKYLTGLGTIGDRMLILVDIEKLLSSEEMALIDSMAE

Flanking regions ( +/- flanking 50bp)

GAAAATGAACACGTCACACGTCGTGATGCAATAAACAAAGGTAAATAACCATGTCGATGATGGATGAAGATTTAAACAAACTCGATGAAGAGAAAAACGGCGAAGGGTACCTGATTTTTACCCTGGGCGAAGAAGAGTACGGCATTGAGATCCTGAAAGTACAGGAAATCCGTGGTTATGAGCAGGTCACCCGCATTGCGAATACCCCGGATTTTATCAAGGGTGTTACTAACTTACGCGGTGTGATTATCCCGATTATCGATCTGCGTGTGAAGTTCTCCCATCAGAACGTCACTTACAACGACAACACCGTAGTGATTGTGGTCAATCTGAAAGATCGCGTGGTGGGGATTGTGGTGGACGGCGTGTCTGACGTGCTGGTGCTCAAAGATGAGCAGATTGCTCCGGCACCGGATTTTGCGGTCACCTTATCAACCAAATATCTGACCGGCCTGGGCACCATCGGTGACCGGATGCTGATCCTGGTGGATATCGAAAAGCTGCTTTCCAGCGAGGAAATGGCACTCATCGACAGCATGGCTGAATGATAATTCAGCCAAATGGTTTTGGTTAAGCCATCACTAAAGTTTTTTGTCGT