Homologs in group_3331

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11180 FBDBKF_11180 100.0 Morganella morganii S1 - Integrase
EHELCC_05045 EHELCC_05045 100.0 Morganella morganii S2 - Integrase
NLDBIP_05365 NLDBIP_05365 100.0 Morganella morganii S4 - Integrase
HKOGLL_15625 HKOGLL_15625 100.0 Morganella morganii S5 - Integrase

Distribution of the homologs in the orthogroup group_3331

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3331

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_02245
Feature type CDS
Gene -
Product Integrase
Location 19626 - 19886 (strand: 1)
Length 261 (nucleotides) / 86 (amino acids)
In genomic island GI41

Contig

Accession ZDB_360
Length 302856 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3331
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MGDMGDIFRAMREDAKERKQQRLRENTGKLSGIDIPFTQDGSGTIHFSTPAGKVLFYPTTNKIQHKQKVTRGNLERAVALAKSLGA

Flanking regions ( +/- flanking 50bp)

GAGCTCAGGGAAGAAATCGAGTTTTTAACCAAATAAATATGGACTAAATTATGGGCGACATGGGCGATATATTCCGCGCAATGCGTGAAGATGCCAAAGAACGGAAGCAGCAGAGATTAAGAGAAAATACAGGGAAGTTATCAGGGATTGATATTCCATTTACTCAGGACGGAAGCGGAACAATTCATTTTTCAACACCAGCCGGAAAAGTTCTGTTTTACCCCACCACAAATAAAATTCAGCACAAGCAAAAGGTCACACGCGGCAATCTGGAAAGGGCTGTCGCACTGGCTAAAAGTCTTGGTGCATAACCCCACCGTTTCAGGATGAAGCGTAATGCAGGGATGCTGATAACAGAGGA