Homologs in group_3330

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_05045 EHELCC_05045 100.0 Morganella morganii S2 - Integrase
NLDBIP_05365 NLDBIP_05365 100.0 Morganella morganii S4 - Integrase
LHKJJB_02245 LHKJJB_02245 100.0 Morganella morganii S3 - Integrase
HKOGLL_15625 HKOGLL_15625 100.0 Morganella morganii S5 - Integrase

Distribution of the homologs in the orthogroup group_3330

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3330

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_11180
Feature type CDS
Gene -
Product Integrase
Location 58179 - 58439 (strand: -1)
Length 261 (nucleotides) / 86 (amino acids)

Contig

Accession contig_13
Length 135581 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3330
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MGDMGDIFRAMREDAKERKQQRLRENTGKLSGIDIPFTQDGSGTIHFSTPAGKVLFYPTTNKIQHKQKVTRGNLERAVALAKSLGA

Flanking regions ( +/- flanking 50bp)

GAGCTCAGGGAAGAAATCGAGTTTTTAACCAAATAAATATGGACTAAATTATGGGCGACATGGGCGATATATTCCGCGCAATGCGTGAAGATGCCAAAGAACGGAAGCAGCAGAGATTAAGAGAAAATACAGGGAAGTTATCAGGGATTGATATTCCATTTACTCAGGACGGAAGCGGAACAATTCATTTTTCAACACCAGCCGGAAAAGTTCTGTTTTACCCCACCACAAATAAAATTCAGCACAAGCAAAAGGTCACACGCGGCAATCTGGAAAGGGCTGTCGCACTGGCTAAAAGTCTTGGTGCATAACCCCACCGTTTCAGGATGAAGCGTAATGCAGGGATGCTGATAACAGAGGA