Homologs in group_245

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02980 FBDBKF_02980 100.0 Morganella morganii S1 lysR DNA-binding transcriptional regulator, LysR family
EHELCC_03450 EHELCC_03450 100.0 Morganella morganii S2 lysR DNA-binding transcriptional regulator, LysR family
NLDBIP_00010 NLDBIP_00010 100.0 Morganella morganii S4 lysR DNA-binding transcriptional regulator, LysR family
HKOGLL_02065 HKOGLL_02065 100.0 Morganella morganii S5 lysR DNA-binding transcriptional regulator, LysR family
F4V73_RS05020 F4V73_RS05020 33.6 Morganella psychrotolerans - LysR family transcriptional regulator
F4V73_RS05420 F4V73_RS05420 92.0 Morganella psychrotolerans - LysR family transcriptional regulator
PMI_RS06240 PMI_RS06240 68.2 Proteus mirabilis HI4320 - LysR family transcriptional regulator

Distribution of the homologs in the orthogroup group_245

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_245

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P77559 1.74e-104 309 52 1 286 3 ynfL Uncharacterized HTH-type transcriptional regulator YnfL Escherichia coli (strain K12)
Q04778 6.43e-53 178 37 2 279 3 alsR HTH-type transcriptional regulator AlsR Bacillus subtilis (strain 168)
P52670 1.97e-44 155 34 5 298 3 ilvR HTH-type transcriptional regulator IlvR Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
O33945 4.06e-42 150 34 4 282 3 None Probable cat1 operon transcriptional activator Acinetobacter lwoffii
O68014 5.79e-41 147 32 2 273 1 benM HTH-type transcriptional regulator BenM Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P52666 1.19e-38 140 32 4 296 3 budR HTH-type transcriptional regulator BudR Raoultella terrigena
P23841 3.18e-38 139 30 7 297 3 xapR HTH-type transcriptional regulator XapR Escherichia coli (strain K12)
Q05840 1.6e-36 135 30 3 292 3 clcR HTH-type transcriptional regulator ClcR Pseudomonas putida
P07774 1.89e-36 135 33 5 276 1 catM HTH-type transcriptional regulator CatM Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P20667 3.38e-35 131 31 9 298 3 catR HTH-type transcriptional regulator CatR Pseudomonas putida
P42427 4.62e-33 124 34 2 214 3 tfdT HTH-type transcriptional regulator TfdT Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q46M54 1.35e-32 125 33 2 275 1 tfdS HTH-type transcriptional regulator TfdS Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q47141 1.61e-32 124 31 4 293 1 hcaR Hca operon transcriptional activator HcaR Escherichia coli (strain K12)
P70785 2.33e-32 124 29 7 309 3 ttuA HTH-type transcriptional regulator TtuA Agrobacterium vitis
Q46M57 1.21e-31 122 33 2 275 1 tfdR HTH-type transcriptional regulator TdfR Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
P0ACQ4 3.39e-29 116 28 6 297 1 oxyR DNA-binding transcriptional dual regulator OxyR Escherichia coli (strain K12)
P0ACQ5 3.39e-29 116 28 6 297 3 oxyR Hydrogen peroxide-inducible genes activator Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACQ6 3.39e-29 116 28 6 297 3 oxyR Hydrogen peroxide-inducible genes activator Escherichia coli O157:H7
P52665 3.42e-28 108 44 0 143 3 budR HTH-type transcriptional regulator BudR (Fragment) Klebsiella aerogenes
P52669 4.3e-28 113 28 6 311 3 ttuA HTH-type transcriptional regulator TtuA Agrobacterium vitis
P27102 8.11e-28 112 30 6 297 3 tcbR HTH-type transcriptional regulator TcbR Pseudomonas sp. (strain P51)
P37499 5.93e-27 109 28 8 291 3 yybE Uncharacterized HTH-type transcriptional regulator YybE Bacillus subtilis (strain 168)
P71318 1.54e-26 108 26 6 299 3 oxyR Hydrogen peroxide-inducible genes activator Pectobacterium carotovorum subsp. carotovorum
Q9X725 1.61e-26 108 26 6 299 3 oxyR Hydrogen peroxide-inducible genes activator Dickeya chrysanthemi
P20668 4.93e-25 104 29 6 296 1 gltC Transcriptional dual regulator GltC Bacillus subtilis (strain 168)
P44418 1.44e-24 103 24 5 299 3 oxyR Hydrogen peroxide-inducible genes activator Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0ACR8 3.23e-22 97 25 3 293 3 yfeR Uncharacterized HTH-type transcriptional regulator YfeR Shigella flexneri
P0ACR7 3.23e-22 97 25 3 293 3 yfeR Uncharacterized HTH-type transcriptional regulator YfeR Escherichia coli (strain K12)
P52696 3.73e-22 97 27 4 294 3 ybhD Uncharacterized HTH-type transcriptional regulator YbhD Escherichia coli (strain K12)
P39592 5.81e-22 96 28 8 303 3 ywbI Uncharacterized HTH-type transcriptional regulator YwbI Bacillus subtilis (strain 168)
P94403 1.43e-21 95 25 6 297 3 bsdA HTH-type transcriptional regulator BsdA Bacillus subtilis (strain 168)
P94501 6.88e-21 93 25 5 281 1 gltR HTH-type transcriptional regulator GltR Bacillus subtilis (strain 168)
Q9X5P2 8.72e-21 93 31 7 250 2 oxyR Probable hydrogen peroxide-inducible genes activator Streptomyces viridosporus
P27111 8.72e-21 93 29 6 263 1 cynR HTH-type transcriptional regulator CynR Escherichia coli (strain K12)
Q8X4M5 2.16e-20 92 30 8 264 3 cynR HTH-type transcriptional regulator CynR Escherichia coli O157:H7
A4QH19 2.36e-20 92 32 6 253 1 shiR HTH-type transcriptional regulator ShiR Corynebacterium glutamicum (strain R)
P45600 3.06e-20 92 28 8 275 1 cysB HTH-type transcriptional regulator CysB Klebsiella pneumoniae
P06614 3.81e-20 92 28 7 258 1 cysB HTH-type transcriptional regulator CysB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A9F3 1.01e-19 90 28 7 260 3 cysB HTH-type transcriptional regulator CysB Escherichia coli (strain K12)
P0A9F4 1.01e-19 90 28 7 260 3 cysB HTH-type transcriptional regulator CysB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9F5 1.01e-19 90 28 7 260 3 cysB HTH-type transcriptional regulator CysB Escherichia coli O157:H7
O32255 1.7e-18 87 27 11 295 3 yvbU Uncharacterized HTH-type transcriptional regulator YvbU Bacillus subtilis (strain 168)
P49518 2.61e-18 86 30 5 254 3 rbcR Probable RuBisCO transcriptional regulator Trieres chinensis
P77171 5.79e-18 85 32 2 180 3 ydcI Uncharacterized HTH-type transcriptional regulator YdcI Escherichia coli (strain K12)
A0T0G2 5.73e-17 82 32 3 178 3 rbcR Probable RuBisCO transcriptional regulator Phaeodactylum tricornutum (strain CCAP 1055/1)
P45105 1.33e-16 82 26 8 251 3 cysB HTH-type transcriptional regulator CysB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q08597 2.67e-16 80 25 5 300 3 nac Nitrogen assimilation regulatory protein nac Klebsiella aerogenes
Q47005 2.92e-16 80 26 5 260 3 nac Nitrogen assimilation regulatory protein nac Escherichia coli (strain K12)
P52686 5.52e-16 80 36 1 126 3 sdsB SDS degradation transcriptional activation protein Pseudomonas sp. (strain ATCC 19151)
P0ACQ9 5.89e-16 80 26 5 236 3 tdcA HTH-type transcriptional regulator TdcA Shigella flexneri
P0ACQ7 5.89e-16 80 26 5 236 3 tdcA HTH-type transcriptional regulator TdcA Escherichia coli (strain K12)
P0ACQ8 5.89e-16 80 26 5 236 3 tdcA HTH-type transcriptional regulator TdcA Escherichia coli O157:H7
A7Z5E4 1.82e-15 78 28 4 251 3 yofA HTH-type transcriptional regulator YofA Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P94387 2.47e-15 78 23 6 313 3 ycgK Uncharacterized HTH-type transcriptional regulator YcgK Bacillus subtilis (strain 168)
O87324 7.69e-15 77 27 8 298 3 oxyR Probable hydrogen peroxide-inducible genes activator Mycobacterium marinum
A0T0V5 1.32e-14 76 30 3 178 3 rbcR-A Probable RuBisCO transcriptional regulator Thalassiosira pseudonana
O34685 1.44e-14 75 27 9 296 1 yofA HTH-type transcriptional regulator YofA Bacillus subtilis (strain 168)
Q57748 1.51e-14 75 24 7 284 3 MJ0300 Uncharacterized HTH-type transcriptional regulator MJ0300 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P77744 3.83e-14 74 29 4 178 3 abgR HTH-type transcriptional regulator AbgR Escherichia coli (strain K12)
P48271 4.16e-14 74 26 7 257 3 rbcR Probable RuBisCO transcriptional regulator Cyanophora paradoxa
Q44311 4.71e-14 74 24 9 298 3 soxR HTH-type transcriptional regulator SoxR Arthrobacter sp. (strain TE1826)
Q1XDT2 6.28e-14 74 27 6 252 3 rbcR Probable RuBisCO transcriptional regulator Neopyropia yezoensis
P51205 8.07e-14 73 27 6 252 3 rbcR Probable RuBisCO transcriptional regulator Porphyra purpurea
Q85G62 1.29e-13 73 30 4 183 3 rbcR Probable RuBisCO transcriptional regulator Cyanidioschyzon merolae (strain NIES-3377 / 10D)
P42722 1.79e-13 73 24 6 289 3 cfxR HTH-type transcriptional regulator CfxR Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q3MCB5 3.15e-13 72 25 9 293 3 rbcR Probable RuBisCO transcriptional regulator Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q8YQ82 3.34e-13 72 29 3 158 3 rbcR Probable RuBisCO transcriptional regulator Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q55459 5.36e-13 71 25 8 289 1 cmpR HTH-type transcriptional activator CmpR Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P52661 5.7e-13 71 26 4 225 1 gbpR HTH-type transcriptional regulator GbpR Azospirillum brasilense
P39647 5.86e-13 71 25 7 295 1 cysL HTH-type transcriptional regulator CysL Bacillus subtilis (strain 168)
P25547 6.38e-13 71 28 6 200 3 gbpR HTH-type transcriptional regulator GbpR Rhizobium radiobacter
Q06610 7.1e-13 71 25 5 290 3 rbcR RuBisCO operon transcriptional regulator Acidithiobacillus ferrooxidans
P71025 1.15e-12 70 25 8 294 3 czcR HTH-type transcriptional regulator CzcR Bacillus subtilis (strain 168)
P74422 2.05e-12 69 25 6 255 3 ntcB Probable nitrogen assimilation transcriptional activator Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P05827 2.45e-12 69 24 4 262 3 ilvY HTH-type transcriptional regulator IlvY Escherichia coli (strain K12)
O33812 2.69e-12 68 24 10 281 3 None Uncharacterized HTH-type transcriptional regulator in lacR 5'region (Fragment) Staphylococcus xylosus
O34827 6.2e-12 68 27 3 149 3 ykuM Uncharacterized HTH-type transcriptional regulator YkuM Bacillus subtilis (strain 168)
P73123 1.02e-11 68 29 2 145 3 rbcR Probable RuBisCO transcriptional regulator Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q6B936 1.05e-11 67 29 3 158 3 rbcR Probable RuBisCO transcriptional regulator Gracilaria tenuistipitata var. liui
P52678 1.4e-11 67 26 7 252 3 oxyR Probable hydrogen peroxide-inducible genes activator Mycobacterium leprae (strain TN)
O19892 1.56e-11 67 24 7 253 3 rbcR Probable RuBisCO transcriptional regulator Cyanidium caldarium
P0A9G1 2.19e-11 67 26 8 257 3 metR HTH-type transcriptional regulator MetR Shigella flexneri
P0A9F9 2.19e-11 67 26 8 257 1 metR HTH-type transcriptional regulator MetR Escherichia coli (strain K12)
P0A9G0 2.19e-11 67 26 8 257 3 metR HTH-type transcriptional regulator MetR Escherichia coli O157:H7
O78432 2.43e-11 66 25 6 255 3 rbcR Probable RuBisCO transcriptional regulator Guillardia theta
P0A2Q2 3.27e-11 66 24 3 259 3 ilvY HTH-type transcriptional activator IlvY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2Q3 3.27e-11 66 24 3 259 3 ilvY HTH-type transcriptional activator IlvY Salmonella typhi
P25544 4.75e-11 65 26 11 295 3 rbcR RuBisCO operon transcriptional regulator Allochromatium vinosum
P0A2Q4 4.83e-11 65 25 8 257 3 metR HTH-type transcriptional regulator MetR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2Q5 4.83e-11 65 25 8 257 3 metR HTH-type transcriptional regulator MetR Salmonella typhi
O35038 5.24e-11 65 23 5 266 3 ytlI HTH-type transcriptional regulator YtlI Bacillus subtilis (strain 168)
P52667 5.38e-11 65 27 2 146 3 estR HTH-type transcriptional regulator EstR Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P45349 6.2e-11 65 25 1 176 3 metR HTH-type transcriptional regulator MetR Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A2CI69 1.04e-10 64 28 2 139 3 rbcR Probable RuBisCO transcriptional regulator Chlorokybus atmophyticus
P52677 1.22e-10 64 28 7 252 3 oxyR Probable hydrogen peroxide-inducible genes activator Mycobacterium avium
O87883 1.42e-10 62 29 2 172 3 oxyR Probable hydrogen peroxide-inducible genes activator (Fragment) Mycobacterium xenopi
P25545 1.43e-10 64 28 9 299 3 cbbR HTH-type transcriptional regulator CbbR Xanthobacter flavus
P44821 2.12e-10 63 28 4 163 3 ilvY HTH-type transcriptional activator IlvY Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A0R8S0 2.87e-10 63 25 7 251 3 czcR HTH-type transcriptional regulator CzcR Bacillus thuringiensis (strain Al Hakam)
P0A4T7 6.13e-10 62 38 1 88 3 pcaQ HTH-type transcriptional regulator PcaQ Rhizobium radiobacter
P0A4T6 6.13e-10 62 38 1 88 3 pcaQ HTH-type transcriptional regulator PcaQ Agrobacterium fabrum (strain C58 / ATCC 33970)
Q6HPH4 1.03e-09 61 25 7 250 3 czcR HTH-type transcriptional regulator CzcR Bacillus thuringiensis subsp. konkukian (strain 97-27)
O32186 1.09e-09 61 24 4 245 3 yusT Uncharacterized HTH-type transcriptional regulator YusT Bacillus subtilis (strain 168)
Q4G384 1.13e-09 62 23 5 255 3 rbcR Probable RuBisCO transcriptional regulator Emiliania huxleyi
Q63H01 1.17e-09 61 25 7 250 3 czcR HTH-type transcriptional regulator CzcR Bacillus cereus (strain ZK / E33L)
Q73EY2 1.17e-09 61 25 7 250 3 czcR HTH-type transcriptional regulator CzcR Bacillus cereus (strain ATCC 10987 / NRS 248)
Q81IX0 1.29e-09 61 25 7 250 3 czcR HTH-type transcriptional regulator CzcR Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P52595 1.54e-09 61 25 9 297 3 cbbR HTH-type transcriptional regulator CbbR Rhodospirillum rubrum
Q9HWH8 1.75e-09 60 25 9 284 3 nmoR HTH-type transcriptional regulator NmoR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O07906 2.66e-09 60 22 7 237 3 yraN Uncharacterized HTH-type transcriptional regulator YraN Bacillus subtilis (strain 168)
Q8KA72 2.81e-09 60 21 8 258 3 metR HTH-type transcriptional regulator MetR Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P0ACR4 2.92e-09 60 21 6 293 1 yeiE Uncharacterized HTH-type transcriptional regulator YeiE Escherichia coli (strain K12)
P0ACR5 2.92e-09 60 21 6 293 3 yeiE Uncharacterized HTH-type transcriptional regulator YeiE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACR6 2.92e-09 60 21 6 293 3 yeiE Uncharacterized HTH-type transcriptional regulator YeiE Escherichia coli O157:H7
P16400 3.51e-09 60 23 11 306 3 mleR Malolactic fermentation system transcriptional activator Lactococcus lactis subsp. lactis (strain IL1403)
A1JI47 3.52e-09 60 31 3 133 3 hdfR HTH-type transcriptional regulator HdfR Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q81VJ1 4.07e-09 60 26 8 250 3 czcR HTH-type transcriptional regulator CzcR Bacillus anthracis
P96194 6.48e-09 57 42 0 76 3 None Uncharacterized HTH-type transcriptional regulator in ibpB-leuC intergenic region Azotobacter vinelandii
Q1R4H3 1.23e-08 58 26 3 172 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain UTI89 / UPEC)
P59369 1.23e-08 58 26 3 172 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAV4 1.23e-08 58 26 3 172 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7N260 1.23e-08 58 26 3 172 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O81 (strain ED1a)
B7MGH6 1.23e-08 58 26 3 172 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O45:K1 (strain S88 / ExPEC)
B7LUJ5 1.61e-08 58 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7NU32 1.93e-08 57 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q3YVK2 1.95e-08 57 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Shigella sonnei (strain Ss046)
P0A8S0 1.95e-08 57 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Shigella flexneri
Q0SYV7 1.95e-08 57 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Shigella flexneri serotype 5b (strain 8401)
Q329U3 1.95e-08 57 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Shigella dysenteriae serotype 1 (strain Sd197)
Q31UM0 1.95e-08 57 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Shigella boydii serotype 4 (strain Sb227)
B1LLU0 1.95e-08 57 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain SMS-3-5 / SECEC)
B6I4A0 1.95e-08 57 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain SE11)
P0A8R9 1.95e-08 57 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain K12)
B1IWY2 1.95e-08 57 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A6M0 1.95e-08 57 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O9:H4 (strain HS)
B1X9Y2 1.95e-08 57 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain K12 / DH10B)
C4ZZ35 1.95e-08 57 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain K12 / MC4100 / BW2952)
B7M5B2 1.95e-08 57 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O8 (strain IAI1)
B5YY14 1.95e-08 57 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XAW1 1.95e-08 57 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O157:H7
B7L8A6 1.95e-08 57 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli (strain 55989 / EAEC)
B7UMM1 1.95e-08 57 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZTW7 1.95e-08 57 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O139:H28 (strain E24377A / ETEC)
B7NF72 2e-08 57 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B2TU26 2.08e-08 57 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
O34701 4.99e-08 56 25 15 305 3 yoaU Uncharacterized HTH-type transcriptional regulator YoaU Bacillus subtilis (strain 168)
B4TNR5 6.98e-08 56 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Salmonella schwarzengrund (strain CVM19633)
B4SYF7 7.25e-08 56 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Salmonella newport (strain SL254)
B5FN59 7.38e-08 56 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Salmonella dublin (strain CT_02021853)
P0A2Q0 7.59e-08 56 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2Q1 7.59e-08 56 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Salmonella typhi
B5BIR0 7.59e-08 56 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Salmonella paratyphi A (strain AKU_12601)
C0Q2U0 7.59e-08 56 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Salmonella paratyphi C (strain RKS4594)
A9MXD5 7.59e-08 56 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PJZ0 7.59e-08 56 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TAZ8 7.59e-08 56 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Salmonella heidelberg (strain SL476)
B5EZ22 7.59e-08 56 35 1 95 3 hdfR HTH-type transcriptional regulator HdfR Salmonella agona (strain SL483)
Q9L127 8.77e-08 56 25 4 181 3 mprR Small neutral protease regulatory protein Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P43161 9.1e-08 56 25 4 181 3 mprR Small neutral protease regulatory protein Streptomyces lividans
O06703 1.38e-07 55 26 2 166 3 bbuR HTH-type transcriptional regulator BbuR Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
P0A9F6 1.46e-07 55 39 1 86 1 gcvA Glycine cleavage system transcriptional activator Escherichia coli (strain K12)
P0A9F7 1.46e-07 55 39 1 86 3 gcvA Glycine cleavage system transcriptional activator Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9F8 1.46e-07 55 39 1 86 3 gcvA Glycine cleavage system transcriptional activator Escherichia coli O157:H7
Q5N5I5 1.59e-07 55 22 6 289 3 cmpR HTH-type transcriptional activator CmpR Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q9F1R2 1.59e-07 55 22 6 289 1 cmpR HTH-type transcriptional activator CmpR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
B1JQ39 1.7e-07 55 30 3 133 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66G51 1.7e-07 55 30 3 133 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TRF4 1.7e-07 55 30 3 133 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis (strain Pestoides F)
Q1CNN4 1.7e-07 55 30 3 133 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis bv. Antiqua (strain Nepal516)
A9R8E7 1.7e-07 55 30 3 133 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis bv. Antiqua (strain Angola)
Q8ZAA7 1.7e-07 55 30 3 133 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis
B2JZG4 1.7e-07 55 30 3 133 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CBT5 1.7e-07 55 30 3 133 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pestis bv. Antiqua (strain Antiqua)
A7FD20 1.7e-07 55 30 3 133 3 hdfR HTH-type transcriptional regulator HdfR Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
P52662 1.71e-07 55 25 6 249 3 pecT HTH-type transcriptional regulator PecT Dickeya dadantii (strain 3937)
B4E8S9 2.95e-07 54 24 10 257 1 ssuR HTH-type transcriptional regulator SsuR Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
P30864 3.15e-07 54 27 4 159 3 yafC Uncharacterized HTH-type transcriptional regulator YafC Escherichia coli (strain K12)
Q9JXW7 3.8e-07 54 29 6 163 1 crgA HTH-type transcriptional regulator CrgA Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P0ACR0 5.21e-07 53 26 1 179 1 allS HTH-type transcriptional activator AllS Escherichia coli (strain K12)
P0ACR1 5.21e-07 53 26 1 179 3 allS HTH-type transcriptional activator AllS Escherichia coli O157:H7
P55181 7.63e-07 53 32 0 88 3 yxjO Uncharacterized HTH-type transcriptional regulator YxjO Bacillus subtilis (strain 168)
Q9JPU9 8e-07 53 26 12 250 1 crgA HTH-type transcriptional regulator CrgA Neisseria meningitidis serogroup C (strain 8013)
P77333 8.76e-07 53 26 4 161 1 pgrR HTH-type transcriptional regulator PgrR Escherichia coli (strain K12)
Q8FK66 9.1e-07 53 26 1 179 3 allS HTH-type transcriptional activator AllS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TKD7 9.1e-07 53 26 1 179 3 allS HTH-type transcriptional activator AllS Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q01610 9.37e-07 53 28 2 138 3 PA2220 Putative transcriptional regulator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P44876 1.14e-06 52 28 2 99 3 HI_0775 Uncharacterized HTH-type transcriptional regulator HI_0775 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P42507 1.25e-06 52 26 3 130 3 hvrB AhcY transcriptional activator HvrB Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P94678 1.34e-06 52 29 3 151 1 tsaR HTH-type transcriptional regulator TsaR Comamonas testosteroni
P77309 1.91e-06 52 22 10 291 3 yneJ Uncharacterized HTH-type transcriptional regulator YneJ Escherichia coli (strain K12)
Q1RF30 2.15e-06 52 26 1 179 3 allS HTH-type transcriptional activator AllS Escherichia coli (strain UTI89 / UPEC)
A1A8H0 2.15e-06 52 26 1 179 3 allS HTH-type transcriptional activator AllS Escherichia coli O1:K1 / APEC
Q47083 2.32e-06 52 25 7 238 1 cbl HTH-type transcriptional regulator cbl Escherichia coli (strain K12)
Q08598 2.68e-06 51 26 9 257 3 cbl HTH-type transcriptional regulator cbl Klebsiella aerogenes
P52044 4.1e-06 50 28 2 102 3 ygfI Uncharacterized HTH-type transcriptional regulator YgfI Escherichia coli (strain K12)
P16931 5.26e-06 50 23 6 248 3 dgdR HTH-type transcriptional regulator DgdR Burkholderia cepacia
Q9S4Y7 5.55e-06 50 24 1 179 3 allS HTH-type transcriptional activator AllS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PCH2 5.55e-06 50 24 1 179 3 allS HTH-type transcriptional activator AllS Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q765S2 6.82e-06 50 31 0 96 3 allS HTH-type transcriptional activator AllS Klebsiella pneumoniae
Q57S50 1.1e-05 49 24 1 179 3 allS HTH-type transcriptional activator AllS Salmonella choleraesuis (strain SC-B67)
Q8Z8R3 1.33e-05 49 24 1 179 3 allS HTH-type transcriptional activator AllS Salmonella typhi
P12529 1.75e-05 48 23 4 152 1 ampR HTH-type transcriptional activator AmpR Citrobacter freundii
P67662 1.75e-05 49 25 1 126 3 aaeR HTH-type transcriptional activator AaeR Escherichia coli (strain K12)
P67663 1.75e-05 49 25 1 126 3 aaeR HTH-type transcriptional activator AaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P67664 1.75e-05 49 25 1 126 3 aaeR HTH-type transcriptional activator AaeR Escherichia coli O157:H7
P37641 2.03e-05 48 37 0 72 3 yhjC Uncharacterized HTH-type transcriptional regulator YhjC Escherichia coli (strain K12)
P45099 2.12e-05 48 24 2 141 3 gcvA Glycine cleavage system transcriptional activator homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P58332 4.32e-05 48 28 10 263 3 cbbR HTH-type transcriptional regulator CbbR Rhizobium meliloti (strain 1021)
P45461 5e-05 47 40 0 65 3 ampR HTH-type transcriptional activator AmpR Yersinia enterocolitica
P37459 7.23e-05 47 26 2 123 3 sinR Probable HTH-type transcriptional regulator SinR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P56885 8.3e-05 47 26 8 259 3 cbbR HTH-type transcriptional regulator CbbR Sinorhizobium medicae (strain WSM419)
P43160 8.69e-05 47 24 9 252 3 mprR Small neutral protease regulatory protein Streptomyces coelicolor
P52660 0.000714 44 22 6 222 3 blaA HTH-type transcriptional regulator BlaA Proteus vulgaris
P52691 0.000752 44 22 6 248 3 lrrA Probable HTH-type transcriptional regulator LrrA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P52692 0.000792 43 30 0 68 3 nhaR Transcriptional activator protein NhaR Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_02025
Feature type CDS
Gene lysR
Product DNA-binding transcriptional regulator, LysR family
Location 389736 - 390635 (strand: -1)
Length 900 (nucleotides) / 299 (amino acids)

Contig

Accession ZDB_359
Length 392768 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_245
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00126 Bacterial regulatory helix-turn-helix protein, lysR family
PF03466 LysR substrate binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0583 Transcription (K) K DNA-binding transcriptional regulator, LysR family

Protein Sequence

MIEFRHLRYFIAVAEELHFGRAAERLNISQPPLSQQIQALENAIPAKLLARNNRNVSLTPAGEMFLREAYQIRTQVEAAVEKAARMDRGELGEVSVGFTSTTPFMRHITATFRQYREIYPDVAIHMHQMNTKQQINPLLSGRIDFGVMRNTQLPDNLVHELLFKERFMLAVYDDHPLMKYLKTGIPLEMLTGVPLVFFERDVGTALYDEIINLLKKAGVTPVIAQEAGEAMTILGLVSAGLGVSLVTESFTRMKVDGVRYIHLAENQAFSEVWLVYHKHNTLSPAGQRLIEMLKNNVFR

Flanking regions ( +/- flanking 50bp)

AATATATTAATACTCTTGTTTGATATGTTTTACGACCTAATGAGGGAATAATGATCGAATTCCGCCATCTGCGTTATTTCATTGCGGTCGCTGAAGAGCTGCATTTCGGACGGGCAGCGGAGCGTCTCAATATCTCCCAGCCTCCGCTCAGTCAGCAGATTCAGGCACTTGAAAACGCGATTCCGGCTAAATTACTGGCACGGAACAACCGGAATGTCAGTCTGACCCCGGCGGGCGAAATGTTTCTGCGTGAAGCTTACCAAATCCGTACTCAGGTCGAGGCAGCGGTTGAAAAAGCAGCCAGAATGGATCGCGGGGAACTGGGGGAAGTTTCTGTCGGCTTCACTTCCACAACCCCGTTTATGCGTCATATTACGGCGACATTCCGCCAGTACCGTGAAATATACCCGGATGTGGCTATCCACATGCATCAGATGAATACCAAACAGCAGATTAACCCGCTGCTGAGCGGCCGGATTGACTTCGGTGTAATGCGCAATACGCAACTGCCGGATAATCTGGTTCATGAACTGCTGTTTAAAGAACGATTTATGCTGGCGGTCTATGATGATCATCCGCTGATGAAATACCTCAAAACGGGCATTCCCCTGGAGATGCTCACTGGCGTACCATTGGTTTTCTTTGAGCGGGATGTGGGAACGGCGCTGTATGATGAGATTATCAATCTGCTGAAAAAAGCGGGTGTCACACCGGTTATCGCCCAGGAAGCAGGGGAAGCTATGACTATTCTGGGGCTGGTCTCTGCCGGGTTAGGTGTTTCACTGGTAACGGAATCTTTTACCCGTATGAAAGTGGATGGTGTCCGTTACATTCATTTAGCTGAAAATCAGGCATTTTCTGAGGTCTGGCTGGTGTATCATAAGCACAATACACTTTCTCCGGCCGGTCAGCGGCTGATTGAGATGCTGAAAAATAATGTGTTCCGCTGAGCGGGATCTGACTGTCAGGAGTTCGGATGTTCCGGCGATACCGGTTTTCT