Homologs in group_2529

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01780 FBDBKF_01780 100.0 Morganella morganii S1 - hypothetical protein
EHELCC_02250 EHELCC_02250 100.0 Morganella morganii S2 - hypothetical protein
NLDBIP_01210 NLDBIP_01210 100.0 Morganella morganii S4 - hypothetical protein
HKOGLL_00865 HKOGLL_00865 100.0 Morganella morganii S5 - hypothetical protein
F4V73_RS19300 F4V73_RS19300 66.7 Morganella psychrotolerans - hypothetical protein

Distribution of the homologs in the orthogroup group_2529

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2529

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_00825
Feature type CDS
Gene -
Product hypothetical protein
Location 144983 - 145156 (strand: -1)
Length 174 (nucleotides) / 57 (amino acids)
In genomic island -

Contig

Accession ZDB_359
Length 392768 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2529
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Protein Sequence

MHPLVDEMIEEIVGTACAYDDDEVDVRVQESRNRVQIQISVTDKPVMDIILNLTRIS

Flanking regions ( +/- flanking 50bp)

TTCAAAACGTTATACTACGCAGCCATCAATACGAATTCCGGAGAATAACGATGCATCCGCTGGTCGATGAGATGATAGAAGAAATAGTCGGCACCGCCTGTGCCTATGATGACGATGAGGTTGATGTCCGTGTGCAGGAAAGCCGCAACCGGGTGCAGATTCAGATTAGTGTGACCGATAAACCGGTCATGGACATTATCCTGAATCTGACCCGCATCAGCTAAACGCGCGGACGCTTGCGGTACAACCACAAACCAGGAACAGACAGCCCGAT