Homologs in group_2498

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_02250 EHELCC_02250 100.0 Morganella morganii S2 - hypothetical protein
NLDBIP_01210 NLDBIP_01210 100.0 Morganella morganii S4 - hypothetical protein
LHKJJB_00825 LHKJJB_00825 100.0 Morganella morganii S3 - hypothetical protein
HKOGLL_00865 HKOGLL_00865 100.0 Morganella morganii S5 - hypothetical protein
F4V73_RS19300 F4V73_RS19300 66.7 Morganella psychrotolerans - hypothetical protein

Distribution of the homologs in the orthogroup group_2498

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2498

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_01780
Feature type CDS
Gene -
Product hypothetical protein
Location 44614 - 44787 (strand: -1)
Length 174 (nucleotides) / 57 (amino acids)

Contig

Accession contig_2
Length 292399 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2498
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Protein Sequence

MHPLVDEMIEEIVGTACAYDDDEVDVRVQESRNRVQIQISVTDKPVMDIILNLTRIS

Flanking regions ( +/- flanking 50bp)

TTCAAAACGTTATACTACGCAGCCATCAATACGAATTCCGGAGAATAACGATGCATCCGCTGGTCGATGAGATGATAGAAGAAATAGTCGGCACCGCCTGTGCCTATGATGACGATGAGGTTGATGTCCGTGTGCAGGAAAGCCGCAACCGGGTGCAGATTCAGATTAGTGTGACCGATAAACCGGTCATGGACATTATCCTGAATCTGACCCGCATCAGCTAAACGCGCGGACGCTTGCGGTACAACCACAAACCAGGAACAGACAGCCCGAT