Homologs in group_2400

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19250 FBDBKF_19250 100.0 Morganella morganii S1 rpsJ_V57L 30S ribosomal protein S10
EHELCC_18995 EHELCC_18995 100.0 Morganella morganii S2 rpsJ_V57L 30S ribosomal protein S10
NLDBIP_19010 NLDBIP_19010 100.0 Morganella morganii S4 rpsJ_V57L 30S ribosomal protein S10
LHKJJB_18865 LHKJJB_18865 100.0 Morganella morganii S3 rpsJ_V57L 30S ribosomal protein S10
F4V73_RS18915 F4V73_RS18915 100.0 Morganella psychrotolerans rpsJ 30S ribosomal protein S10
PMI_RS16145 PMI_RS16145 100.0 Proteus mirabilis HI4320 rpsJ 30S ribosomal protein S10

Distribution of the homologs in the orthogroup group_2400

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2400

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B1JIW0 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664S0 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TGZ1 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Yersinia pestis (strain Pestoides F)
Q1CCU3 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R8Z5 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Yersinia pestis bv. Antiqua (strain Angola)
P67906 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Yersinia pestis
B2K5N1 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2U6 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNN6 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JS48 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GKJ8 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Serratia proteamaculans (strain 568)
P67904 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67905 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Salmonella typhi
B4TXE3 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Salmonella schwarzengrund (strain CVM19633)
B5BGY7 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Salmonella paratyphi A (strain AKU_12601)
C0Q0B7 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Salmonella paratyphi C (strain RKS4594)
A9MT00 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PIV1 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUU1 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Salmonella newport (strain SL254)
B4TKL6 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Salmonella heidelberg (strain SL476)
B5RH14 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R292 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Salmonella enteritidis PT4 (strain P125109)
B5FJL5 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Salmonella dublin (strain CT_02021853)
Q57J31 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Salmonella choleraesuis (strain SC-B67)
A9MN45 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F8F3 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Salmonella agona (strain SL483)
B4F1I3 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Proteus mirabilis (strain HI4320)
P67903 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C6DG75 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
P67902 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Pasteurella multocida (strain Pm70)
Q65QV4 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A6TEX3 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XN93 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Klebsiella pneumoniae (strain 342)
B0UX12 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Histophilus somni (strain 2336)
Q0I164 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Histophilus somni (strain 129Pt)
P67901 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UHS9 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Haemophilus influenzae (strain PittGG)
A5UDU7 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Haemophilus influenzae (strain PittEE)
Q4QMC3 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Haemophilus influenzae (strain 86-028NP)
B8F754 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Glaesserella parasuis serovar 5 (strain SH0165)
B7LS41 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B2VK34 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C5BGM6 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Edwardsiella ictaluri (strain 93-146)
A7MPI6 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Cronobacter sakazakii (strain ATCC BAA-894)
A8AQM1 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A6VLI7 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B0BST0 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZ10 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N357 1.72e-70 208 100 0 103 3 rpsJ Small ribosomal subunit protein uS10 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q2NQM1 2.73e-70 207 99 0 103 3 rpsJ Small ribosomal subunit protein uS10 Sodalis glossinidius (strain morsitans)
Q6CZW9 2.73e-70 207 99 0 103 3 rpsJ Small ribosomal subunit protein uS10 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A4WFC9 2.73e-70 207 99 0 103 3 rpsJ Small ribosomal subunit protein uS10 Enterobacter sp. (strain 638)
Q8K949 4.33e-70 207 98 0 103 3 rpsJ Small ribosomal subunit protein uS10 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
C4L7S9 7.57e-70 206 99 0 103 3 rpsJ Small ribosomal subunit protein uS10 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q12SW0 8.18e-70 206 99 0 103 3 rpsJ Small ribosomal subunit protein uS10 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q7VKD1 9.43e-70 206 99 0 103 3 rpsJ Small ribosomal subunit protein uS10 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A1S217 1.9e-69 205 98 0 103 3 rpsJ Small ribosomal subunit protein uS10 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q089Q5 2.4e-69 205 98 0 103 3 rpsJ Small ribosomal subunit protein uS10 Shewanella frigidimarina (strain NCIMB 400)
B8D850 3.64e-69 204 96 0 103 3 rpsJ Small ribosomal subunit protein uS10 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57592 3.64e-69 204 96 0 103 3 rpsJ Small ribosomal subunit protein uS10 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9U8 3.64e-69 204 96 0 103 3 rpsJ Small ribosomal subunit protein uS10 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q0I0A6 4.29e-69 204 97 0 103 3 rpsJ Small ribosomal subunit protein uS10 Shewanella sp. (strain MR-7)
Q0HNT8 4.29e-69 204 97 0 103 3 rpsJ Small ribosomal subunit protein uS10 Shewanella sp. (strain MR-4)
A0KRM3 4.29e-69 204 97 0 103 3 rpsJ Small ribosomal subunit protein uS10 Shewanella sp. (strain ANA-3)
Q8EK69 4.29e-69 204 97 0 103 3 rpsJ Small ribosomal subunit protein uS10 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A3Q981 4.29e-69 204 97 0 103 3 rpsJ Small ribosomal subunit protein uS10 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A1T0E3 4.84e-69 204 95 0 103 3 rpsJ Small ribosomal subunit protein uS10 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A1REB3 8.38e-69 204 96 0 103 3 rpsJ Small ribosomal subunit protein uS10 Shewanella sp. (strain W3-18-1)
A4YBY4 8.38e-69 204 96 0 103 3 rpsJ Small ribosomal subunit protein uS10 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A9KWA1 8.38e-69 204 96 0 103 3 rpsJ Small ribosomal subunit protein uS10 Shewanella baltica (strain OS195)
A6WHS7 8.38e-69 204 96 0 103 3 rpsJ Small ribosomal subunit protein uS10 Shewanella baltica (strain OS185)
A3DA73 8.38e-69 204 96 0 103 3 rpsJ Small ribosomal subunit protein uS10 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBK6 8.38e-69 204 96 0 103 3 rpsJ Small ribosomal subunit protein uS10 Shewanella baltica (strain OS223)
Q3YWT8 9.36e-69 203 98 0 103 3 rpsJ Small ribosomal subunit protein uS10 Shigella sonnei (strain Ss046)
P0A7R8 9.36e-69 203 98 0 103 3 rpsJ Small ribosomal subunit protein uS10 Shigella flexneri
Q0SZY2 9.36e-69 203 98 0 103 3 rpsJ Small ribosomal subunit protein uS10 Shigella flexneri serotype 5b (strain 8401)
Q32B30 9.36e-69 203 98 0 103 3 rpsJ Small ribosomal subunit protein uS10 Shigella dysenteriae serotype 1 (strain Sd197)
Q31VV5 9.36e-69 203 98 0 103 3 rpsJ Small ribosomal subunit protein uS10 Shigella boydii serotype 4 (strain Sb227)
B2U2T9 9.36e-69 203 98 0 103 3 rpsJ Small ribosomal subunit protein uS10 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R601 9.36e-69 203 98 0 103 3 rpsJ Small ribosomal subunit protein uS10 Escherichia coli (strain UTI89 / UPEC)
B1LHD5 9.36e-69 203 98 0 103 3 rpsJ Small ribosomal subunit protein uS10 Escherichia coli (strain SMS-3-5 / SECEC)
B6I235 9.36e-69 203 98 0 103 3 rpsJ Small ribosomal subunit protein uS10 Escherichia coli (strain SE11)
B7NDU2 9.36e-69 203 98 0 103 3 rpsJ Small ribosomal subunit protein uS10 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7R5 9.36e-69 203 98 0 103 1 rpsJ Small ribosomal subunit protein uS10 Escherichia coli (strain K12)
B1IPX8 9.36e-69 203 98 0 103 3 rpsJ Small ribosomal subunit protein uS10 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7R6 9.36e-69 203 98 0 103 3 rpsJ Small ribosomal subunit protein uS10 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCE0 9.36e-69 203 98 0 103 3 rpsJ Small ribosomal subunit protein uS10 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGK8 9.36e-69 203 98 0 103 3 rpsJ Small ribosomal subunit protein uS10 Escherichia coli O1:K1 / APEC
A8A5C6 9.36e-69 203 98 0 103 3 rpsJ Small ribosomal subunit protein uS10 Escherichia coli O9:H4 (strain HS)
B1X6H2 9.36e-69 203 98 0 103 3 rpsJ Small ribosomal subunit protein uS10 Escherichia coli (strain K12 / DH10B)
C4ZUH6 9.36e-69 203 98 0 103 3 rpsJ Small ribosomal subunit protein uS10 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1N5 9.36e-69 203 98 0 103 3 rpsJ Small ribosomal subunit protein uS10 Escherichia coli O8 (strain IAI1)
B7N1A5 9.36e-69 203 98 0 103 3 rpsJ Small ribosomal subunit protein uS10 Escherichia coli O81 (strain ED1a)
B7NLP0 9.36e-69 203 98 0 103 3 rpsJ Small ribosomal subunit protein uS10 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YTP2 9.36e-69 203 98 0 103 3 rpsJ Small ribosomal subunit protein uS10 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7R7 9.36e-69 203 98 0 103 3 rpsJ Small ribosomal subunit protein uS10 Escherichia coli O157:H7
B7L4L0 9.36e-69 203 98 0 103 3 rpsJ Small ribosomal subunit protein uS10 Escherichia coli (strain 55989 / EAEC)
B7MCT6 9.36e-69 203 98 0 103 3 rpsJ Small ribosomal subunit protein uS10 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UK45 9.36e-69 203 98 0 103 3 rpsJ Small ribosomal subunit protein uS10 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSL0 9.36e-69 203 98 0 103 3 rpsJ Small ribosomal subunit protein uS10 Escherichia coli O139:H28 (strain E24377A / ETEC)
Q6LVB7 1.64e-68 203 96 0 103 3 rpsJ Small ribosomal subunit protein uS10 Photobacterium profundum (strain SS9)
B0TM13 1.66e-68 203 96 0 103 3 rpsJ Small ribosomal subunit protein uS10 Shewanella halifaxensis (strain HAW-EB4)
Q493K9 2.84e-68 202 96 0 103 3 rpsJ Small ribosomal subunit protein uS10 Blochmanniella pennsylvanica (strain BPEN)
B1KMY4 4.91e-68 202 95 0 103 3 rpsJ Small ribosomal subunit protein uS10 Shewanella woodyi (strain ATCC 51908 / MS32)
A8G1E9 4.91e-68 202 95 0 103 3 rpsJ Small ribosomal subunit protein uS10 Shewanella sediminis (strain HAW-EB3)
A8GYX5 4.91e-68 202 95 0 103 3 rpsJ Small ribosomal subunit protein uS10 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B6EPS4 9.49e-68 201 95 0 103 3 rpsJ Small ribosomal subunit protein uS10 Aliivibrio salmonicida (strain LFI1238)
B5FG08 9.49e-68 201 95 0 103 3 rpsJ Small ribosomal subunit protein uS10 Aliivibrio fischeri (strain MJ11)
Q5E8B7 9.49e-68 201 95 0 103 3 rpsJ Small ribosomal subunit protein uS10 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q89A67 1.22e-67 201 96 0 102 3 rpsJ Small ribosomal subunit protein uS10 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
C3LRQ9 1.22e-67 201 95 0 103 3 rpsJ Small ribosomal subunit protein uS10 Vibrio cholerae serotype O1 (strain M66-2)
Q9KNY3 1.22e-67 201 95 0 103 3 rpsJ Small ribosomal subunit protein uS10 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F550 1.22e-67 201 95 0 103 3 rpsJ Small ribosomal subunit protein uS10 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q5QXY9 1.33e-67 201 95 0 103 3 rpsJ Small ribosomal subunit protein uS10 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q8D213 2.41e-67 200 93 0 103 3 rpsJ Small ribosomal subunit protein uS10 Wigglesworthia glossinidia brevipalpis
Q487Z2 3.11e-67 199 93 0 103 3 rpsJ Small ribosomal subunit protein uS10 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q3IF26 5.81e-67 199 95 0 103 3 rpsJ Small ribosomal subunit protein uS10 Pseudoalteromonas translucida (strain TAC 125)
B3PK36 6.27e-67 199 94 0 103 3 rpsJ Small ribosomal subunit protein uS10 Cellvibrio japonicus (strain Ueda107)
B4RZN1 7.23e-67 199 94 0 103 3 rpsJ Small ribosomal subunit protein uS10 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q7MPI9 1.02e-66 198 94 0 103 3 rpsJ Small ribosomal subunit protein uS10 Vibrio vulnificus (strain YJ016)
P66347 1.02e-66 198 94 0 103 3 rpsJ Small ribosomal subunit protein uS10 Vibrio vulnificus (strain CMCP6)
P66346 1.02e-66 198 94 0 103 3 rpsJ Small ribosomal subunit protein uS10 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MWI2 1.02e-66 198 94 0 103 3 rpsJ Small ribosomal subunit protein uS10 Vibrio campbellii (strain ATCC BAA-1116)
Q4ZMP3 2.07e-66 197 92 0 103 3 rpsJ Small ribosomal subunit protein uS10 Pseudomonas syringae pv. syringae (strain B728a)
Q889X2 2.07e-66 197 92 0 103 3 rpsJ Small ribosomal subunit protein uS10 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48D35 2.07e-66 197 92 0 103 3 rpsJ Small ribosomal subunit protein uS10 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q15YP0 6.57e-66 196 92 0 103 3 rpsJ Small ribosomal subunit protein uS10 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q1IFW7 8.36e-66 196 92 0 103 3 rpsJ Small ribosomal subunit protein uS10 Pseudomonas entomophila (strain L48)
Q9HWD4 8.36e-66 196 92 0 103 1 rpsJ Small ribosomal subunit protein uS10 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02T81 8.36e-66 196 92 0 103 3 rpsJ Small ribosomal subunit protein uS10 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V643 8.36e-66 196 92 0 103 3 rpsJ Small ribosomal subunit protein uS10 Pseudomonas aeruginosa (strain LESB58)
A6UZI7 8.36e-66 196 92 0 103 3 rpsJ Small ribosomal subunit protein uS10 Pseudomonas aeruginosa (strain PA7)
A4VHM9 1.18e-65 196 91 0 103 3 rpsJ Small ribosomal subunit protein uS10 Stutzerimonas stutzeri (strain A1501)
B1JDW5 1.18e-65 196 91 0 103 3 rpsJ Small ribosomal subunit protein uS10 Pseudomonas putida (strain W619)
Q88QN6 1.18e-65 196 91 0 103 3 rpsJ Small ribosomal subunit protein uS10 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KK66 1.18e-65 196 91 0 103 3 rpsJ Small ribosomal subunit protein uS10 Pseudomonas putida (strain GB-1)
Q3K5Y7 1.18e-65 196 91 0 103 3 rpsJ Small ribosomal subunit protein uS10 Pseudomonas fluorescens (strain Pf0-1)
A5VXP6 1.18e-65 196 91 0 103 3 rpsJ Small ribosomal subunit protein uS10 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
C3K2X7 1.18e-65 196 91 0 103 3 rpsJ Small ribosomal subunit protein uS10 Pseudomonas fluorescens (strain SBW25)
Q4K532 1.18e-65 196 91 0 103 3 rpsJ Small ribosomal subunit protein uS10 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q2S911 1.2e-65 196 92 0 103 3 rpsJ Small ribosomal subunit protein uS10 Hahella chejuensis (strain KCTC 2396)
Q21M58 1.55e-65 195 91 0 103 3 rpsJ Small ribosomal subunit protein uS10 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A1TYJ6 1.67e-65 195 91 0 103 3 rpsJ Small ribosomal subunit protein uS10 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q1LTD9 1.67e-65 195 93 0 103 3 rpsJ Small ribosomal subunit protein uS10 Baumannia cicadellinicola subsp. Homalodisca coagulata
A4XZ91 1.69e-65 195 91 0 103 3 rpsJ Small ribosomal subunit protein uS10 Pseudomonas mendocina (strain ymp)
C1DKL2 1.69e-65 195 91 0 103 3 rpsJ Small ribosomal subunit protein uS10 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q057A3 3.06e-65 194 91 0 103 3 rpsJ Small ribosomal subunit protein uS10 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q0VSK4 3.64e-65 194 92 0 103 3 rpsJ Small ribosomal subunit protein uS10 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q7VQE9 1.23e-64 193 89 0 103 3 rpsJ Small ribosomal subunit protein uS10 Blochmanniella floridana
A6W393 2.23e-64 192 90 0 103 3 rpsJ Small ribosomal subunit protein uS10 Marinomonas sp. (strain MWYL1)
Q1R0H6 6e-63 189 89 0 102 3 rpsJ Small ribosomal subunit protein uS10 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q605B1 2.05e-62 187 87 0 103 3 rpsJ Small ribosomal subunit protein uS10 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q6F7R1 3.48e-61 184 85 0 103 3 rpsJ Small ribosomal subunit protein uS10 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A3M984 7.68e-61 183 85 0 103 3 rpsJ Small ribosomal subunit protein uS10 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2HZM3 7.68e-61 183 85 0 103 3 rpsJ Small ribosomal subunit protein uS10 Acinetobacter baumannii (strain ACICU)
B7IA40 7.68e-61 183 85 0 103 1 rpsJ Small ribosomal subunit protein uS10 Acinetobacter baumannii (strain AB0057)
B7GW01 7.68e-61 183 85 0 103 3 rpsJ Small ribosomal subunit protein uS10 Acinetobacter baumannii (strain AB307-0294)
Q1QDI7 7.93e-61 183 85 0 103 3 rpsJ Small ribosomal subunit protein uS10 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FUF7 7.93e-61 183 85 0 103 3 rpsJ Small ribosomal subunit protein uS10 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q0ABH6 8.76e-61 183 85 0 102 3 rpsJ Small ribosomal subunit protein uS10 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A4IZT5 9.74e-61 183 84 0 103 3 rpsJ Small ribosomal subunit protein uS10 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NHW9 9.74e-61 183 84 0 103 3 rpsJ Small ribosomal subunit protein uS10 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
A0Q4I2 9.74e-61 183 84 0 103 3 rpsJ Small ribosomal subunit protein uS10 Francisella tularensis subsp. novicida (strain U112)
B2SDY6 9.74e-61 183 84 0 103 3 rpsJ Small ribosomal subunit protein uS10 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q14JC1 9.74e-61 183 84 0 103 3 rpsJ Small ribosomal subunit protein uS10 Francisella tularensis subsp. tularensis (strain FSC 198)
Q0BNS8 2.17e-60 182 83 0 103 3 rpsJ Small ribosomal subunit protein uS10 Francisella tularensis subsp. holarctica (strain OSU18)
Q2A5H1 2.17e-60 182 83 0 103 3 rpsJ Small ribosomal subunit protein uS10 Francisella tularensis subsp. holarctica (strain LVS)
A7N9S5 2.17e-60 182 83 0 103 3 rpsJ Small ribosomal subunit protein uS10 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
B0U0Z0 2.17e-60 182 83 0 103 3 rpsJ Small ribosomal subunit protein uS10 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A5WCI9 2.38e-60 182 84 0 103 3 rpsJ Small ribosomal subunit protein uS10 Psychrobacter sp. (strain PRwf-1)
Q31IY3 3.27e-60 182 85 0 102 3 rpsJ Small ribosomal subunit protein uS10 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
B8GV59 3.69e-60 182 84 0 103 3 rpsJ Small ribosomal subunit protein uS10 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q3J8R3 6.17e-60 181 88 0 101 3 rpsJ Small ribosomal subunit protein uS10 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q5WZL3 3.9e-58 177 85 0 101 3 rpsJ Small ribosomal subunit protein uS10 Legionella pneumophila (strain Lens)
Q5ZYP4 3.9e-58 177 85 0 101 3 rpsJ Small ribosomal subunit protein uS10 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IHR5 3.9e-58 177 85 0 101 3 rpsJ Small ribosomal subunit protein uS10 Legionella pneumophila (strain Corby)
Q5X860 3.9e-58 177 85 0 101 3 rpsJ Small ribosomal subunit protein uS10 Legionella pneumophila (strain Paris)
B2FQ44 1.01e-56 173 80 0 102 3 rpsJ Small ribosomal subunit protein uS10 Stenotrophomonas maltophilia (strain K279a)
B4SKW2 1.01e-56 173 80 0 102 3 rpsJ Small ribosomal subunit protein uS10 Stenotrophomonas maltophilia (strain R551-3)
A5CXK3 1.67e-56 172 78 0 103 3 rpsJ Small ribosomal subunit protein uS10 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A1AVJ9 2.2e-56 172 78 0 103 3 rpsJ Small ribosomal subunit protein uS10 Ruthia magnifica subsp. Calyptogena magnifica
Q8PC50 5.96e-56 171 78 0 102 3 rpsJ Small ribosomal subunit protein uS10 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RU83 5.96e-56 171 78 0 102 3 rpsJ Small ribosomal subunit protein uS10 Xanthomonas campestris pv. campestris (strain B100)
Q4URD8 5.96e-56 171 78 0 102 3 rpsJ Small ribosomal subunit protein uS10 Xanthomonas campestris pv. campestris (strain 8004)
Q8PNS5 7.26e-56 171 78 0 102 3 rpsJ Small ribosomal subunit protein uS10 Xanthomonas axonopodis pv. citri (strain 306)
Q83ES5 8.19e-56 171 84 0 100 3 rpsJ Small ribosomal subunit protein uS10 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAM3 8.19e-56 171 84 0 100 3 rpsJ Small ribosomal subunit protein uS10 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KD32 8.19e-56 171 84 0 100 3 rpsJ Small ribosomal subunit protein uS10 Coxiella burnetii (strain Dugway 5J108-111)
Q3BWY4 4.89e-55 169 78 0 100 3 rpsJ Small ribosomal subunit protein uS10 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B2UEM0 1.27e-54 168 79 0 102 3 rpsJ Small ribosomal subunit protein uS10 Ralstonia pickettii (strain 12J)
Q5GWT2 1.97e-54 167 77 0 101 3 rpsJ Small ribosomal subunit protein uS10 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SQQ9 1.97e-54 167 77 0 101 3 rpsJ Small ribosomal subunit protein uS10 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NZY4 1.97e-54 167 77 0 101 3 rpsJ Small ribosomal subunit protein uS10 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A5EX83 2.3e-54 167 77 0 100 3 rpsJ Small ribosomal subunit protein uS10 Dichelobacter nodosus (strain VCS1703A)
A4SUW0 8.22e-54 166 79 0 102 3 rpsJ Small ribosomal subunit protein uS10 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q8XV11 9.78e-54 166 79 0 101 3 rpsJ Small ribosomal subunit protein uS10 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A9IJ03 1.55e-53 165 77 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q13TG9 1.68e-53 165 78 0 102 3 rpsJ Small ribosomal subunit protein uS10 Paraburkholderia xenovorans (strain LB400)
B2T752 1.68e-53 165 78 0 102 3 rpsJ Small ribosomal subunit protein uS10 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
B2JIG7 1.68e-53 165 78 0 102 3 rpsJ Small ribosomal subunit protein uS10 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q5P333 1.75e-53 165 77 0 102 3 rpsJ Small ribosomal subunit protein uS10 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B3R7S9 2.5e-53 164 76 0 102 3 rpsJ Small ribosomal subunit protein uS10 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q46WE2 2.5e-53 164 76 0 102 3 rpsJ Small ribosomal subunit protein uS10 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q0K613 2.5e-53 164 76 0 102 3 rpsJ Small ribosomal subunit protein uS10 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q1LI31 2.5e-53 164 76 0 102 3 rpsJ Small ribosomal subunit protein uS10 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q0AIJ6 2.72e-53 164 77 0 102 3 rpsJ Small ribosomal subunit protein uS10 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q7VTD4 3.03e-53 164 77 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WRC6 3.03e-53 164 77 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q2L2G3 3.03e-53 164 77 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bordetella avium (strain 197N)
A1KB28 3.58e-53 164 77 0 102 3 rpsJ Small ribosomal subunit protein uS10 Azoarcus sp. (strain BH72)
Q82X89 4.41e-53 164 77 0 102 3 rpsJ Small ribosomal subunit protein uS10 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q3SLQ0 4.71e-53 164 76 0 102 3 rpsJ Small ribosomal subunit protein uS10 Thiobacillus denitrificans (strain ATCC 25259)
Q47JA4 5.19e-53 164 78 0 102 3 rpsJ Small ribosomal subunit protein uS10 Dechloromonas aromatica (strain RCB)
B1XSQ0 1e-52 163 78 0 102 3 rpsJ Small ribosomal subunit protein uS10 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A4JAN9 1.7e-52 162 77 0 102 3 rpsJ Small ribosomal subunit protein uS10 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q2SU26 1.7e-52 162 77 0 102 3 rpsJ Small ribosomal subunit protein uS10 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63Q10 1.7e-52 162 77 0 102 3 rpsJ Small ribosomal subunit protein uS10 Burkholderia pseudomallei (strain K96243)
A3NEI0 1.7e-52 162 77 0 102 3 rpsJ Small ribosomal subunit protein uS10 Burkholderia pseudomallei (strain 668)
Q3JMR2 1.7e-52 162 77 0 102 3 rpsJ Small ribosomal subunit protein uS10 Burkholderia pseudomallei (strain 1710b)
A3P0B4 1.7e-52 162 77 0 102 3 rpsJ Small ribosomal subunit protein uS10 Burkholderia pseudomallei (strain 1106a)
Q1BRU7 1.7e-52 162 77 0 102 3 rpsJ Small ribosomal subunit protein uS10 Burkholderia orbicola (strain AU 1054)
B1JU21 1.7e-52 162 77 0 102 3 rpsJ Small ribosomal subunit protein uS10 Burkholderia orbicola (strain MC0-3)
A1V8A4 1.7e-52 162 77 0 102 3 rpsJ Small ribosomal subunit protein uS10 Burkholderia mallei (strain SAVP1)
Q62GK4 1.7e-52 162 77 0 102 3 rpsJ Small ribosomal subunit protein uS10 Burkholderia mallei (strain ATCC 23344)
A2S7H5 1.7e-52 162 77 0 102 3 rpsJ Small ribosomal subunit protein uS10 Burkholderia mallei (strain NCTC 10229)
A3MRV3 1.7e-52 162 77 0 102 3 rpsJ Small ribosomal subunit protein uS10 Burkholderia mallei (strain NCTC 10247)
A9ADJ2 1.7e-52 162 77 0 102 3 rpsJ Small ribosomal subunit protein uS10 Burkholderia multivorans (strain ATCC 17616 / 249)
Q39KG8 1.7e-52 162 77 0 102 3 rpsJ Small ribosomal subunit protein uS10 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BJ47 1.7e-52 162 77 0 102 3 rpsJ Small ribosomal subunit protein uS10 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B4E5B9 1.7e-52 162 77 0 102 3 rpsJ Small ribosomal subunit protein uS10 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K3M4 1.7e-52 162 77 0 102 3 rpsJ Small ribosomal subunit protein uS10 Burkholderia cenocepacia (strain HI2424)
B1YRC9 1.7e-52 162 77 0 102 3 rpsJ Small ribosomal subunit protein uS10 Burkholderia ambifaria (strain MC40-6)
Q2RQV9 2.12e-52 162 76 0 102 3 rpsJ Small ribosomal subunit protein uS10 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q7W2F7 2.23e-52 162 76 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q0ANP9 2.36e-52 162 74 0 103 3 rpsJ Small ribosomal subunit protein uS10 Maricaulis maris (strain MCS10)
A2SLF8 4.09e-52 161 74 0 102 3 rpsJ Small ribosomal subunit protein uS10 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
B1Y7H1 4.13e-52 161 74 0 102 3 rpsJ Small ribosomal subunit protein uS10 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q2YAZ8 4.28e-52 161 76 0 102 3 rpsJ Small ribosomal subunit protein uS10 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q6MJ14 4.44e-52 161 71 0 103 3 rpsJ Small ribosomal subunit protein uS10 Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q1H4N8 4.77e-52 161 76 0 102 3 rpsJ Small ribosomal subunit protein uS10 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q2W2J0 6.14e-52 161 75 0 102 3 rpsJ Small ribosomal subunit protein uS10 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
A1TJ06 6.34e-52 161 74 0 102 3 rpsJ Small ribosomal subunit protein uS10 Paracidovorax citrulli (strain AAC00-1)
A9BPR7 6.34e-52 161 74 0 102 3 rpsJ Small ribosomal subunit protein uS10 Delftia acidovorans (strain DSM 14801 / SPH-1)
A1W2Q6 6.34e-52 161 74 0 102 3 rpsJ Small ribosomal subunit protein uS10 Acidovorax sp. (strain JS42)
B9MB72 6.34e-52 161 74 0 102 3 rpsJ Small ribosomal subunit protein uS10 Acidovorax ebreus (strain TPSY)
Q1GK38 1.11e-51 160 75 0 102 3 rpsJ Small ribosomal subunit protein uS10 Ruegeria sp. (strain TM1040)
Q5LLU5 1.11e-51 160 75 0 102 3 rpsJ Small ribosomal subunit protein uS10 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
A4J110 1.61e-51 160 71 0 102 3 rpsJ Small ribosomal subunit protein uS10 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q250N3 1.86e-51 160 72 0 102 3 rpsJ Small ribosomal subunit protein uS10 Desulfitobacterium hafniense (strain Y51)
B8G1W5 1.86e-51 160 72 0 102 3 rpsJ Small ribosomal subunit protein uS10 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
A1WHC4 3.47e-51 159 74 0 102 3 rpsJ Small ribosomal subunit protein uS10 Verminephrobacter eiseniae (strain EF01-2)
Q211E7 3.84e-51 159 75 0 102 3 rpsJ Small ribosomal subunit protein uS10 Rhodopseudomonas palustris (strain BisB18)
B6IRQ5 4.01e-51 159 73 0 102 3 rpsJ Small ribosomal subunit protein uS10 Rhodospirillum centenum (strain ATCC 51521 / SW)
A0L5X2 5.32e-51 159 71 0 102 3 rpsJ Small ribosomal subunit protein uS10 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A1B026 5.89e-51 158 73 0 102 3 rpsJ Small ribosomal subunit protein uS10 Paracoccus denitrificans (strain Pd 1222)
B3QBY1 5.95e-51 158 75 0 102 3 rpsJ Small ribosomal subunit protein uS10 Rhodopseudomonas palustris (strain TIE-1)
Q134S8 5.95e-51 158 75 0 102 3 rpsJ Small ribosomal subunit protein uS10 Rhodopseudomonas palustris (strain BisB5)
Q6N4T6 5.95e-51 158 75 0 102 1 rpsJ Small ribosomal subunit protein uS10 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q07KL7 5.95e-51 158 75 0 102 3 rpsJ Small ribosomal subunit protein uS10 Rhodopseudomonas palustris (strain BisA53)
Q2IXR1 5.95e-51 158 75 0 102 3 rpsJ Small ribosomal subunit protein uS10 Rhodopseudomonas palustris (strain HaA2)
Q3SSW7 5.95e-51 158 75 0 102 3 rpsJ Small ribosomal subunit protein uS10 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q1QN31 5.95e-51 158 75 0 102 3 rpsJ Small ribosomal subunit protein uS10 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A4YSJ1 5.95e-51 158 75 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bradyrhizobium sp. (strain ORS 278)
A5ELM8 5.95e-51 158 75 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q89J83 5.95e-51 158 75 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
B9KL90 6.09e-51 158 73 0 102 3 rpsJ Small ribosomal subunit protein uS10 Cereibacter sphaeroides (strain KD131 / KCTC 12085)
A4WVK9 6.09e-51 158 73 0 102 3 rpsJ Small ribosomal subunit protein uS10 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q3J5S3 6.09e-51 158 73 0 102 3 rpsJ Small ribosomal subunit protein uS10 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PGL0 6.09e-51 158 73 0 102 3 rpsJ Small ribosomal subunit protein uS10 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A0LII9 6.49e-51 158 71 0 102 3 rpsJ Small ribosomal subunit protein uS10 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q0BUQ1 6.94e-51 158 75 0 102 3 rpsJ Small ribosomal subunit protein uS10 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q5FTY2 6.94e-51 158 75 0 102 3 rpsJ Small ribosomal subunit protein uS10 Gluconobacter oxydans (strain 621H)
B0TC55 7.02e-51 158 72 0 102 3 rpsJ Small ribosomal subunit protein uS10 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
B6JET2 7.75e-51 158 75 0 102 3 rpsJ Small ribosomal subunit protein uS10 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
C1DAR6 7.99e-51 158 73 0 102 3 rpsJ Small ribosomal subunit protein uS10 Laribacter hongkongensis (strain HLHK9)
B0UHX0 8.93e-51 158 74 0 102 3 rpsJ Small ribosomal subunit protein uS10 Methylobacterium sp. (strain 4-46)
B8IS84 8.93e-51 158 74 0 102 3 rpsJ Small ribosomal subunit protein uS10 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q21RV7 9.61e-51 158 75 0 100 3 rpsJ Small ribosomal subunit protein uS10 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B2IK61 1.12e-50 158 74 0 102 3 rpsJ Small ribosomal subunit protein uS10 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
A7IFY0 1.46e-50 157 74 0 102 3 rpsJ Small ribosomal subunit protein uS10 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
A8IAS9 1.46e-50 157 74 0 102 3 rpsJ Small ribosomal subunit protein uS10 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A9H3R6 1.63e-50 157 74 0 102 3 rpsJ Small ribosomal subunit protein uS10 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q98N58 2.06e-50 157 74 0 102 3 rpsJ Small ribosomal subunit protein uS10 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q2RFP6 2.4e-50 157 72 0 102 3 rpsJ Small ribosomal subunit protein uS10 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
C5CP56 2.64e-50 157 75 0 100 3 rpsJ Small ribosomal subunit protein uS10 Variovorax paradoxus (strain S110)
Q12GX2 2.64e-50 157 75 0 100 3 rpsJ Small ribosomal subunit protein uS10 Polaromonas sp. (strain JS666 / ATCC BAA-500)
A1VIP9 2.64e-50 157 75 0 100 3 rpsJ Small ribosomal subunit protein uS10 Polaromonas naphthalenivorans (strain CJ2)
A5FZW6 3.84e-50 156 74 0 102 3 rpsJ Small ribosomal subunit protein uS10 Acidiphilium cryptum (strain JF-5)
A6U858 5.17e-50 156 73 0 102 3 rpsJ Small ribosomal subunit protein uS10 Sinorhizobium medicae (strain WSM419)
C3MAX9 5.17e-50 156 73 0 102 3 rpsJ Small ribosomal subunit protein uS10 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q92QH1 5.17e-50 156 73 0 102 3 rpsJ Small ribosomal subunit protein uS10 Rhizobium meliloti (strain 1021)
Q16AF5 5.43e-50 156 74 0 101 3 rpsJ Small ribosomal subunit protein uS10 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
B9JVN6 6.09e-50 156 73 0 102 3 rpsJ Small ribosomal subunit protein uS10 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q7NQF1 6.28e-50 156 74 0 102 3 rpsJ Small ribosomal subunit protein uS10 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A7HWR0 6.65e-50 156 73 0 102 3 rpsJ Small ribosomal subunit protein uS10 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
B8ELG4 7.26e-50 155 73 0 102 3 rpsJ Small ribosomal subunit protein uS10 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q8UE17 7.67e-50 155 73 0 102 3 rpsJ Small ribosomal subunit protein uS10 Agrobacterium fabrum (strain C58 / ATCC 33970)
A5D5I9 7.93e-50 155 69 0 102 3 rpsJ Small ribosomal subunit protein uS10 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
B5ZYT4 8.01e-50 155 72 0 102 3 rpsJ Small ribosomal subunit protein uS10 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q1MIE2 8.01e-50 155 72 0 102 3 rpsJ Small ribosomal subunit protein uS10 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q2K9L7 8.01e-50 155 72 0 102 3 rpsJ Small ribosomal subunit protein uS10 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PWS0 8.01e-50 155 72 0 102 3 rpsJ Small ribosomal subunit protein uS10 Rhizobium etli (strain CIAT 652)
B0U5A6 1.06e-49 155 73 0 102 3 rpsJ Small ribosomal subunit protein uS10 Xylella fastidiosa (strain M12)
P66325 1.19e-49 155 72 0 102 3 rpsJ Small ribosomal subunit protein uS10 Brucella suis biovar 1 (strain 1330)
B0CH33 1.19e-49 155 72 0 102 3 rpsJ Small ribosomal subunit protein uS10 Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VR07 1.19e-49 155 72 0 102 3 rpsJ Small ribosomal subunit protein uS10 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P66324 1.19e-49 155 72 0 102 3 rpsJ Small ribosomal subunit protein uS10 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RJK2 1.19e-49 155 72 0 102 3 rpsJ Small ribosomal subunit protein uS10 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M5Q1 1.19e-49 155 72 0 102 3 rpsJ Small ribosomal subunit protein uS10 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57CQ7 1.19e-49 155 72 0 102 3 rpsJ Small ribosomal subunit protein uS10 Brucella abortus biovar 1 (strain 9-941)
A6X0B7 1.19e-49 155 72 0 102 3 rpsJ Small ribosomal subunit protein uS10 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q2YM02 1.19e-49 155 72 0 102 3 rpsJ Small ribosomal subunit protein uS10 Brucella abortus (strain 2308)
B2S680 1.19e-49 155 72 0 102 3 rpsJ Small ribosomal subunit protein uS10 Brucella abortus (strain S19)
Q1D775 1.34e-49 155 72 0 100 3 rpsJ Small ribosomal subunit protein uS10 Myxococcus xanthus (strain DK1622)
Q28UW3 1.6e-49 155 74 0 100 3 rpsJ Small ribosomal subunit protein uS10 Jannaschia sp. (strain CCS1)
B4UB99 2.02e-49 154 72 0 100 3 rpsJ Small ribosomal subunit protein uS10 Anaeromyxobacter sp. (strain K)
A7HBL8 2.02e-49 154 72 0 100 3 rpsJ Small ribosomal subunit protein uS10 Anaeromyxobacter sp. (strain Fw109-5)
Q2IJ85 2.02e-49 154 72 0 100 3 rpsJ Small ribosomal subunit protein uS10 Anaeromyxobacter dehalogenans (strain 2CP-C)
B8J860 2.02e-49 154 72 0 100 3 rpsJ Small ribosomal subunit protein uS10 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
P66349 2.5e-49 154 72 0 102 3 rpsJ Small ribosomal subunit protein uS10 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P66348 2.5e-49 154 72 0 102 3 rpsJ Small ribosomal subunit protein uS10 Xylella fastidiosa (strain 9a5c)
B2I8G8 2.5e-49 154 72 0 102 3 rpsJ Small ribosomal subunit protein uS10 Xylella fastidiosa (strain M23)
A9IW28 3.8e-49 154 71 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q6FZC1 3.98e-49 154 71 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bartonella quintana (strain Toulouse)
Q6G2W4 3.98e-49 154 71 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
B1I1I7 6.1e-49 153 70 0 102 3 rpsJ Small ribosomal subunit protein uS10 Desulforudis audaxviator (strain MP104C)
B4R8L6 6.37e-49 153 72 0 102 3 rpsJ Small ribosomal subunit protein uS10 Phenylobacterium zucineum (strain HLK1)
B1ZLK3 8.2e-49 153 70 0 102 3 rpsJ Small ribosomal subunit protein uS10 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A9W4Q0 8.2e-49 153 70 0 102 3 rpsJ Small ribosomal subunit protein uS10 Methylorubrum extorquens (strain PA1)
B7L0R0 8.2e-49 153 70 0 102 3 rpsJ Small ribosomal subunit protein uS10 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
B3E7T4 1.08e-48 153 69 0 102 3 rpsJ Small ribosomal subunit protein uS10 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q11HQ1 1.22e-48 152 72 0 102 3 rpsJ Small ribosomal subunit protein uS10 Chelativorans sp. (strain BNC1)
B5ELX8 1.85e-48 152 70 0 102 3 rpsJ Small ribosomal subunit protein uS10 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J466 1.85e-48 152 70 0 102 3 rpsJ Small ribosomal subunit protein uS10 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
A1ALU0 2.13e-48 152 69 0 102 3 rpsJ Small ribosomal subunit protein uS10 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
C1F643 3.58e-48 151 72 0 100 3 rpsJ Small ribosomal subunit protein uS10 Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
B8H4D3 5.53e-48 151 72 0 102 3 rpsJ Small ribosomal subunit protein uS10 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A8V4 5.53e-48 151 72 0 102 3 rpsJ Small ribosomal subunit protein uS10 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B0T2C1 5.53e-48 151 72 0 102 3 rpsJ Small ribosomal subunit protein uS10 Caulobacter sp. (strain K31)
Q748Z0 7.44e-48 150 68 0 102 3 rpsJ Small ribosomal subunit protein uS10 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q39Y07 8.67e-48 150 68 0 102 3 rpsJ Small ribosomal subunit protein uS10 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B1LWS5 1.19e-47 150 69 0 102 3 rpsJ Small ribosomal subunit protein uS10 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q1GP98 1.22e-47 150 66 0 103 3 rpsJ Small ribosomal subunit protein uS10 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q3A6P8 1.67e-47 150 68 0 102 3 rpsJ Small ribosomal subunit protein uS10 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q3A9R5 2.46e-47 149 64 0 102 3 rpsJ Small ribosomal subunit protein uS10 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
A1KRH2 2.71e-47 149 70 0 102 3 rpsJ Small ribosomal subunit protein uS10 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
C6E4Q8 3.98e-47 149 67 0 102 3 rpsJ Small ribosomal subunit protein uS10 Geobacter sp. (strain M21)
B5EFP9 3.98e-47 149 67 0 102 3 rpsJ Small ribosomal subunit protein uS10 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
B0SSH8 4.96e-47 149 72 0 100 3 rpsJ Small ribosomal subunit protein uS10 Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SAF5 4.96e-47 149 72 0 100 3 rpsJ Small ribosomal subunit protein uS10 Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
B8FET6 5.06e-47 149 65 0 102 3 rpsJ Small ribosomal subunit protein uS10 Desulfatibacillum aliphaticivorans
B9M6U6 5.18e-47 149 67 0 102 3 rpsJ Small ribosomal subunit protein uS10 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
P66333 9.98e-47 148 70 0 102 3 rpsJ Small ribosomal subunit protein uS10 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66332 9.98e-47 148 70 0 102 3 rpsJ Small ribosomal subunit protein uS10 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M3W8 9.98e-47 148 70 0 102 3 rpsJ Small ribosomal subunit protein uS10 Neisseria meningitidis serogroup C (strain 053442)
Q5F5S5 9.98e-47 148 70 0 102 3 rpsJ Small ribosomal subunit protein uS10 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B0K5P2 1.03e-46 148 68 0 102 3 rpsJ Small ribosomal subunit protein uS10 Thermoanaerobacter sp. (strain X514)
B0KCJ9 1.03e-46 148 68 0 102 3 rpsJ Small ribosomal subunit protein uS10 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q01W91 1.04e-46 148 73 0 97 3 rpsJ Small ribosomal subunit protein uS10 Solibacter usitatus (strain Ellin6076)
Q38UR1 1.05e-46 148 66 0 102 3 rpsJ Small ribosomal subunit protein uS10 Latilactobacillus sakei subsp. sakei (strain 23K)
B1KSM6 1.12e-46 147 68 0 102 3 rpsJ Small ribosomal subunit protein uS10 Clostridium botulinum (strain Loch Maree / Type A3)
A7GJ75 1.12e-46 147 68 0 102 3 rpsJ Small ribosomal subunit protein uS10 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IGF5 1.12e-46 147 68 0 102 3 rpsJ Small ribosomal subunit protein uS10 Clostridium botulinum (strain Okra / Type B1)
C1FMV2 1.12e-46 147 68 0 102 3 rpsJ Small ribosomal subunit protein uS10 Clostridium botulinum (strain Kyoto / Type A2)
A5I7K7 1.12e-46 147 68 0 102 3 rpsJ Small ribosomal subunit protein uS10 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
C3KVQ2 1.12e-46 147 68 0 102 3 rpsJ Small ribosomal subunit protein uS10 Clostridium botulinum (strain 657 / Type Ba4)
A7FZ70 1.12e-46 147 68 0 102 3 rpsJ Small ribosomal subunit protein uS10 Clostridium botulinum (strain ATCC 19397 / Type A)
Q0BYB3 1.36e-46 147 67 0 102 3 rpsJ Small ribosomal subunit protein uS10 Hyphomonas neptunium (strain ATCC 15444)
Q6AP72 1.41e-46 147 66 0 100 3 rpsJ Small ribosomal subunit protein uS10 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
B8I7X8 1.5e-46 147 68 1 103 3 rpsJ Small ribosomal subunit protein uS10 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q8R7V3 1.53e-46 147 66 0 102 3 rpsJ Small ribosomal subunit protein uS10 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q1ISC3 1.69e-46 147 69 0 98 3 rpsJ Small ribosomal subunit protein uS10 Koribacter versatilis (strain Ellin345)
Q04C16 2.41e-46 147 62 0 102 3 rpsJ Small ribosomal subunit protein uS10 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GBL9 2.41e-46 147 62 0 102 3 rpsJ Small ribosomal subunit protein uS10 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q034Y2 2.9e-46 147 66 0 102 3 rpsJ Small ribosomal subunit protein uS10 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WAL8 2.9e-46 147 66 0 102 3 rpsJ Small ribosomal subunit protein uS10 Lacticaseibacillus casei (strain BL23)
Q97EH7 3.03e-46 147 67 0 102 3 rpsJ Small ribosomal subunit protein uS10 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A5N4P6 3.38e-46 146 66 0 102 3 rpsJ Small ribosomal subunit protein uS10 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DYA8 3.38e-46 146 66 0 102 3 rpsJ Small ribosomal subunit protein uS10 Clostridium kluyveri (strain NBRC 12016)
Q2G8Y1 3.48e-46 146 65 0 103 3 rpsJ Small ribosomal subunit protein uS10 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
P48851 4.06e-46 146 69 0 102 3 rpsJ Small ribosomal subunit protein uS10 Neisseria gonorrhoeae
Q9XD37 4.64e-46 146 69 0 100 3 rpsJ Small ribosomal subunit protein uS10 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72NG0 4.64e-46 146 69 0 100 3 rpsJ Small ribosomal subunit protein uS10 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q04PT7 4.64e-46 146 69 0 100 3 rpsJ Small ribosomal subunit protein uS10 Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q2LQA2 7.69e-46 145 65 0 100 3 rpsJ Small ribosomal subunit protein uS10 Syntrophus aciditrophicus (strain SB)
B1YGU9 8.13e-46 145 67 0 102 3 rpsJ Small ribosomal subunit protein uS10 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A3DJH1 1.03e-45 145 67 0 101 3 rpsJ Small ribosomal subunit protein uS10 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q4FLL7 1.15e-45 145 62 0 102 3 rpsJ Small ribosomal subunit protein uS10 Pelagibacter ubique (strain HTCC1062)
Q74L89 1.18e-45 145 63 0 102 3 rpsJ Small ribosomal subunit protein uS10 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q046C6 1.18e-45 145 63 0 102 3 rpsJ Small ribosomal subunit protein uS10 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
B2GDX0 1.27e-45 145 64 0 102 3 rpsJ Small ribosomal subunit protein uS10 Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
A0PXU5 1.53e-45 145 66 0 102 3 rpsJ Small ribosomal subunit protein uS10 Clostridium novyi (strain NT)
Q1WS89 1.89e-45 144 64 0 102 3 rpsJ Small ribosomal subunit protein uS10 Ligilactobacillus salivarius (strain UCC118)
Q88XY7 1.91e-45 144 65 0 102 3 rpsJ Small ribosomal subunit protein uS10 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8ETY3 2.11e-45 144 65 0 102 3 rpsJ Small ribosomal subunit protein uS10 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
C4KZP7 2.2e-45 144 65 0 102 3 rpsJ Small ribosomal subunit protein uS10 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q03EB5 2.54e-45 144 65 0 102 3 rpsJ Small ribosomal subunit protein uS10 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q03PV6 2.81e-45 144 65 0 102 3 rpsJ Small ribosomal subunit protein uS10 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
B2A4D8 2.86e-45 144 65 0 101 3 rpsJ Small ribosomal subunit protein uS10 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
B4RQX4 2.89e-45 144 68 0 102 3 rpsJ Small ribosomal subunit protein uS10 Neisseria gonorrhoeae (strain NCCP11945)
A7Z0N7 3.31e-45 144 65 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P21471 3.31e-45 144 65 0 102 1 rpsJ Small ribosomal subunit protein uS10 Bacillus subtilis (strain 168)
A8F984 3.31e-45 144 65 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bacillus pumilus (strain SAFR-032)
Q65PA8 3.31e-45 144 65 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A8YXK4 3.69e-45 144 62 0 102 3 rpsJ Small ribosomal subunit protein uS10 Lactobacillus helveticus (strain DPC 4571)
Q5FM91 3.69e-45 144 62 0 102 3 rpsJ Small ribosomal subunit protein uS10 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
B2G8X9 4.5e-45 144 64 0 102 3 rpsJ Small ribosomal subunit protein uS10 Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VLK6 4.5e-45 144 64 0 102 3 rpsJ Small ribosomal subunit protein uS10 Limosilactobacillus reuteri (strain DSM 20016)
Q9Z9L5 4.65e-45 144 65 0 102 3 rpsJ Small ribosomal subunit protein uS10 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A0ALW9 6.05e-45 143 65 0 102 3 rpsJ Small ribosomal subunit protein uS10 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
P66330 6.05e-45 143 65 0 102 1 rpsJ Small ribosomal subunit protein uS10 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DB07 6.05e-45 143 65 0 102 3 rpsJ Small ribosomal subunit protein uS10 Listeria monocytogenes serotype 4a (strain HCC23)
Q71WE5 6.05e-45 143 65 0 102 3 rpsJ Small ribosomal subunit protein uS10 Listeria monocytogenes serotype 4b (strain F2365)
C1KZI1 6.05e-45 143 65 0 102 3 rpsJ Small ribosomal subunit protein uS10 Listeria monocytogenes serotype 4b (strain CLIP80459)
P66331 6.05e-45 143 65 0 102 3 rpsJ Small ribosomal subunit protein uS10 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q5WLR3 6.97e-45 143 64 0 102 3 rpsJ Small ribosomal subunit protein uS10 Shouchella clausii (strain KSM-K16)
Q67JU2 9.27e-45 143 64 0 102 3 rpsJ Small ribosomal subunit protein uS10 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
P0CE02 1.26e-44 142 69 0 99 3 rpsJ Small ribosomal subunit protein uS10 Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
B0BC73 1.26e-44 142 69 0 99 3 rpsJ Small ribosomal subunit protein uS10 Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
Q3KLR4 1.26e-44 142 69 0 99 3 rpsJ Small ribosomal subunit protein uS10 Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
B0B808 1.26e-44 142 69 0 99 3 rpsJ Small ribosomal subunit protein uS10 Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
P0A4A2 1.26e-44 142 69 0 99 3 rpsJ Small ribosomal subunit protein uS10 Chlamydia muridarum (strain MoPn / Nigg)
Q73F97 4.86e-44 141 63 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bacillus cereus (strain ATCC 10987 / NRS 248)
A4XBP7 4.96e-44 141 63 0 102 3 rpsJ Small ribosomal subunit protein uS10 Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
A8M530 4.96e-44 141 63 0 102 3 rpsJ Small ribosomal subunit protein uS10 Salinispora arenicola (strain CNS-205)
Q4L8B5 5.48e-44 141 64 0 102 3 rpsJ Small ribosomal subunit protein uS10 Staphylococcus haemolyticus (strain JCSC1435)
Q6HPQ9 6.75e-44 140 63 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63H91 6.75e-44 140 63 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bacillus cereus (strain ZK / E33L)
Q81J43 6.75e-44 140 63 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9IZJ3 6.75e-44 140 63 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bacillus cereus (strain Q1)
A7GK19 6.75e-44 140 63 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B7HQU3 6.75e-44 140 63 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bacillus cereus (strain AH187)
B7HJ47 6.75e-44 140 63 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bacillus cereus (strain B4264)
C1ET38 6.75e-44 140 63 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bacillus cereus (strain 03BB102)
B7JKB8 6.75e-44 140 63 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bacillus cereus (strain AH820)
A0R8H9 6.75e-44 140 63 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bacillus thuringiensis (strain Al Hakam)
B0CCC9 7.23e-44 140 63 0 102 3 rpsJ Small ribosomal subunit protein uS10 Acaryochloris marina (strain MBIC 11017)
A8MLD9 7.49e-44 140 64 0 101 3 rpsJ Small ribosomal subunit protein uS10 Alkaliphilus oremlandii (strain OhILAs)
A9VP76 7.95e-44 140 63 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bacillus mycoides (strain KBAB4)
B7IT18 7.95e-44 140 63 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bacillus cereus (strain G9842)
Q81VT1 1.06e-43 140 63 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bacillus anthracis
C3LJ81 1.06e-43 140 63 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P9Q4 1.06e-43 140 63 0 102 3 rpsJ Small ribosomal subunit protein uS10 Bacillus anthracis (strain A0248)
P72232 1.07e-43 140 62 0 102 3 rpsJ Small ribosomal subunit protein uS10 Planobispora rosea
Q839G5 1.08e-43 140 63 0 102 1 rpsJ Small ribosomal subunit protein uS10 Enterococcus faecalis (strain ATCC 700802 / V583)
Q0SQE3 1.08e-43 140 64 0 102 3 rpsJ Small ribosomal subunit protein uS10 Clostridium perfringens (strain SM101 / Type A)
Q8XHS2 1.08e-43 140 64 0 102 3 rpsJ Small ribosomal subunit protein uS10 Clostridium perfringens (strain 13 / Type A)
Q0TMP5 1.08e-43 140 64 0 102 3 rpsJ Small ribosomal subunit protein uS10 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q47LJ2 1.13e-43 140 63 0 102 3 rpsJ Small ribosomal subunit protein uS10 Thermobifida fusca (strain YX)
B8HV47 1.31e-43 140 61 0 102 3 rpsJ Small ribosomal subunit protein uS10 Cyanothece sp. (strain PCC 7425 / ATCC 29141)
C5D3R6 1.42e-43 140 62 0 102 3 rpsJ Small ribosomal subunit protein uS10 Geobacillus sp. (strain WCH70)
Q03ZP6 1.5e-43 140 61 0 102 3 rpsJ Small ribosomal subunit protein uS10 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
B1MW15 1.5e-43 140 61 0 102 3 rpsJ Small ribosomal subunit protein uS10 Leuconostoc citreum (strain KM20)
Q931G5 1.55e-43 140 64 0 102 1 rpsJ Small ribosomal subunit protein uS10 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HDV7 1.55e-43 140 64 0 102 3 rpsJ Small ribosomal subunit protein uS10 Staphylococcus aureus (strain COL)
A7X5G6 1.55e-43 140 64 0 102 3 rpsJ Small ribosomal subunit protein uS10 Staphylococcus aureus (strain Mu3 / ATCC 700698)
C1CI96 1.59e-43 140 61 0 102 3 rpsJ Small ribosomal subunit protein uS10 Streptococcus pneumoniae (strain P1031)
C1CC05 1.59e-43 140 61 0 102 3 rpsJ Small ribosomal subunit protein uS10 Streptococcus pneumoniae (strain JJA)
P66340 1.59e-43 140 61 0 102 3 rpsJ Small ribosomal subunit protein uS10 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IS39 1.59e-43 140 61 0 102 3 rpsJ Small ribosomal subunit protein uS10 Streptococcus pneumoniae (strain CGSP14)
P66339 1.59e-43 140 61 0 102 3 rpsJ Small ribosomal subunit protein uS10 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZKF6 1.59e-43 140 61 0 102 3 rpsJ Small ribosomal subunit protein uS10 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1I8J7 1.59e-43 140 61 0 102 3 rpsJ Small ribosomal subunit protein uS10 Streptococcus pneumoniae (strain Hungary19A-6)
C1CAL1 1.59e-43 140 61 0 102 3 rpsJ Small ribosomal subunit protein uS10 Streptococcus pneumoniae (strain 70585)
B5E6F4 1.59e-43 140 61 0 102 3 rpsJ Small ribosomal subunit protein uS10 Streptococcus pneumoniae serotype 19F (strain G54)
Q04MN7 1.59e-43 140 61 0 102 3 rpsJ Small ribosomal subunit protein uS10 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A4VYP1 1.62e-43 140 60 0 102 3 rpsJ Small ribosomal subunit protein uS10 Streptococcus suis (strain 98HAH33)
Q253F2 1.65e-43 140 67 0 99 3 rpsJ Small ribosomal subunit protein uS10 Chlamydia felis (strain Fe/C-56)
Q824F9 1.65e-43 140 67 0 99 3 rpsJ Small ribosomal subunit protein uS10 Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q5L6S4 1.65e-43 140 67 0 99 3 rpsJ Small ribosomal subunit protein uS10 Chlamydia abortus (strain DSM 27085 / S26/3)
B9DM20 1.68e-43 140 64 0 102 3 rpsJ Small ribosomal subunit protein uS10 Staphylococcus carnosus (strain TM300)
C0ZIH9 1.79e-43 139 62 0 102 3 rpsJ Small ribosomal subunit protein uS10 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
A4XLT1 1.89e-43 140 61 0 101 3 rpsJ Small ribosomal subunit protein uS10 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
B1W408 1.91e-43 139 62 0 102 3 rpsJ Small ribosomal subunit protein uS10 Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
P66337 1.91e-43 139 62 0 102 3 rpsJ Small ribosomal subunit protein uS10 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P66338 1.91e-43 139 62 0 102 3 rpsJ Small ribosomal subunit protein uS10 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q9Z803 1.94e-43 139 68 0 99 3 rpsJ Small ribosomal subunit protein uS10 Chlamydia pneumoniae
A8LC57 2.16e-43 139 63 0 102 3 rpsJ Small ribosomal subunit protein uS10 Parafrankia sp. (strain EAN1pec)
A4IJI8 2.23e-43 139 61 0 102 3 rpsJ Small ribosomal subunit protein uS10 Geobacillus thermodenitrificans (strain NG80-2)
Q5L3Z8 2.23e-43 139 61 0 102 3 rpsJ Small ribosomal subunit protein uS10 Geobacillus kaustophilus (strain HTA426)
B9E9J0 2.3e-43 139 64 0 102 3 rpsJ Small ribosomal subunit protein uS10 Macrococcus caseolyticus (strain JCSC5402)
Q2JFH7 2.35e-43 139 63 0 102 3 rpsJ Small ribosomal subunit protein uS10 Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q0RRS2 2.35e-43 139 63 0 102 3 rpsJ Small ribosomal subunit protein uS10 Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
B2TIH4 3.1e-43 139 64 0 102 3 rpsJ Small ribosomal subunit protein uS10 Clostridium botulinum (strain Eklund 17B / Type B)
B2UYA9 3.1e-43 139 64 0 102 3 rpsJ Small ribosomal subunit protein uS10 Clostridium botulinum (strain Alaska E43 / Type E3)
A6LPR0 3.1e-43 139 64 0 102 3 rpsJ Small ribosomal subunit protein uS10 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
C1CP87 3.46e-43 139 61 0 102 3 rpsJ Small ribosomal subunit protein uS10 Streptococcus pneumoniae (strain Taiwan19F-14)
A3CK62 3.46e-43 139 60 0 102 3 rpsJ Small ribosomal subunit protein uS10 Streptococcus sanguinis (strain SK36)
A8AZM6 3.46e-43 139 60 0 102 3 rpsJ Small ribosomal subunit protein uS10 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
B9MKI2 3.61e-43 139 61 0 99 3 rpsJ Small ribosomal subunit protein uS10 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
P66336 5.13e-43 138 64 0 102 3 rpsJ Small ribosomal subunit protein uS10 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HLZ8 5.13e-43 138 64 0 102 3 rpsJ Small ribosomal subunit protein uS10 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P66335 5.13e-43 138 64 0 102 3 rpsJ Small ribosomal subunit protein uS10 Staphylococcus aureus (strain MW2)
Q6G770 5.13e-43 138 64 0 102 3 rpsJ Small ribosomal subunit protein uS10 Staphylococcus aureus (strain MSSA476)
Q6GEI2 5.13e-43 138 64 0 102 3 rpsJ Small ribosomal subunit protein uS10 Staphylococcus aureus (strain MRSA252)
P66334 5.13e-43 138 64 0 102 1 rpsJ Small ribosomal subunit protein uS10 Staphylococcus aureus (strain N315)
A6QJ93 5.13e-43 138 64 0 102 3 rpsJ Small ribosomal subunit protein uS10 Staphylococcus aureus (strain Newman)
Q2YYP5 5.13e-43 138 64 0 102 1 rpsJ Small ribosomal subunit protein uS10 Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IV35 5.13e-43 138 64 0 102 1 rpsJ Small ribosomal subunit protein uS10 Staphylococcus aureus (strain JH9)
Q2FEN8 5.13e-43 138 64 0 102 3 rpsJ Small ribosomal subunit protein uS10 Staphylococcus aureus (strain USA300)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_18600
Feature type CDS
Gene rpsJ_V57L
Product 30S ribosomal protein S10
Location 23121 - 23432 (strand: -1)
Length 312 (nucleotides) / 103 (amino acids)

Contig

Accession ZDB_706
Length 24827 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2400
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00338 Ribosomal protein S10p/S20e

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0051 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein S10

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02946 small subunit ribosomal protein S10 Ribosome -

Protein Sequence

MQNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG

Flanking regions ( +/- flanking 50bp)

GTGCGAGGAGTAATTTTTTACGTTTATAAAATAGTTGGAGCTCTGGTCTCATGCAGAACCAAAGAATCCGTATCCGCCTTAAAGCTTTTGATCATCGTCTGATCGATCAATCAACTGCGGAAATCGTAGAGACTGCTAAGCGCACTGGTGCGCAAGTTCGTGGTCCTATCCCGCTGCCGACCCGTAAAGAGCGTTTTACCGTTCTGATCTCTCCGCACGTCAACAAAGATGCGCGCGATCAGTACGAAATTCGCACTCACAAACGTCTGGTTGACATCGTTGAGCCAACTGAAAAAACCGTTGATGCTCTGATGCGTCTGGATCTGGCTGCCGGCGTTGACGTGCAGATCAGCCTGGGTTAATCAGGTATCAATTGATTGAGAGGTTGAAACAATGATTGGTTTAGTCGGTA