Homologs in group_2387

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19185 FBDBKF_19185 100.0 Morganella morganii S1 rplE 50S ribosomal protein L5
EHELCC_18930 EHELCC_18930 100.0 Morganella morganii S2 rplE 50S ribosomal protein L5
NLDBIP_18945 NLDBIP_18945 100.0 Morganella morganii S4 rplE 50S ribosomal protein L5
LHKJJB_18800 LHKJJB_18800 100.0 Morganella morganii S3 rplE 50S ribosomal protein L5
F4V73_RS18980 F4V73_RS18980 97.8 Morganella psychrotolerans rplE 50S ribosomal protein L5
PMI_RS16210 PMI_RS16210 96.6 Proteus mirabilis HI4320 rplE 50S ribosomal protein L5

Distribution of the homologs in the orthogroup group_2387

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2387

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P46178 2.01e-129 363 97 0 179 3 rplE Large ribosomal subunit protein uL5 Buchnera aphidicola subsp. Acyrthosiphon kondoi
C6DG62 4.83e-129 362 97 0 179 3 rplE Large ribosomal subunit protein uL5 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A8GKI5 5.95e-129 362 97 0 179 3 rplE Large ribosomal subunit protein uL5 Serratia proteamaculans (strain 568)
C5BGL3 9.75e-129 361 97 0 179 3 rplE Large ribosomal subunit protein uL5 Edwardsiella ictaluri (strain 93-146)
A7MPH6 1.37e-128 361 97 0 179 3 rplE Large ribosomal subunit protein uL5 Cronobacter sakazakii (strain ATCC BAA-894)
Q6CZY2 1.93e-128 360 97 0 179 3 rplE Large ribosomal subunit protein uL5 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q3YWV1 4.68e-128 359 96 0 179 3 rplE Large ribosomal subunit protein uL5 Shigella sonnei (strain Ss046)
Q0SZZ4 4.68e-128 359 96 0 179 3 rplE Large ribosomal subunit protein uL5 Shigella flexneri serotype 5b (strain 8401)
Q32B43 4.68e-128 359 96 0 179 3 rplE Large ribosomal subunit protein uL5 Shigella dysenteriae serotype 1 (strain Sd197)
Q31VW8 4.68e-128 359 96 0 179 3 rplE Large ribosomal subunit protein uL5 Shigella boydii serotype 4 (strain Sb227)
B2U2S6 4.68e-128 359 96 0 179 3 rplE Large ribosomal subunit protein uL5 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A6TEW0 4.68e-128 359 96 0 179 3 rplE Large ribosomal subunit protein uL5 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B7LRS4 4.68e-128 359 96 0 179 3 rplE Large ribosomal subunit protein uL5 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R620 4.68e-128 359 96 0 179 3 rplE Large ribosomal subunit protein uL5 Escherichia coli (strain UTI89 / UPEC)
B1LHC2 4.68e-128 359 96 0 179 3 rplE Large ribosomal subunit protein uL5 Escherichia coli (strain SMS-3-5 / SECEC)
B6I222 4.68e-128 359 96 0 179 3 rplE Large ribosomal subunit protein uL5 Escherichia coli (strain SE11)
B7NDS9 4.68e-128 359 96 0 179 3 rplE Large ribosomal subunit protein uL5 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P62399 4.68e-128 359 96 0 179 1 rplE Large ribosomal subunit protein uL5 Escherichia coli (strain K12)
B1IPZ1 4.68e-128 359 96 0 179 3 rplE Large ribosomal subunit protein uL5 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P62400 4.68e-128 359 96 0 179 3 rplE Large ribosomal subunit protein uL5 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCF3 4.68e-128 359 96 0 179 3 rplE Large ribosomal subunit protein uL5 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGJ7 4.68e-128 359 96 0 179 3 rplE Large ribosomal subunit protein uL5 Escherichia coli O1:K1 / APEC
A8A5B3 4.68e-128 359 96 0 179 3 rplE Large ribosomal subunit protein uL5 Escherichia coli O9:H4 (strain HS)
B1X6G0 4.68e-128 359 96 0 179 3 rplE Large ribosomal subunit protein uL5 Escherichia coli (strain K12 / DH10B)
C4ZUG3 4.68e-128 359 96 0 179 3 rplE Large ribosomal subunit protein uL5 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1M2 4.68e-128 359 96 0 179 3 rplE Large ribosomal subunit protein uL5 Escherichia coli O8 (strain IAI1)
B7N192 4.68e-128 359 96 0 179 3 rplE Large ribosomal subunit protein uL5 Escherichia coli O81 (strain ED1a)
B7NLM7 4.68e-128 359 96 0 179 3 rplE Large ribosomal subunit protein uL5 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YTM9 4.68e-128 359 96 0 179 3 rplE Large ribosomal subunit protein uL5 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P62401 4.68e-128 359 96 0 179 3 rplE Large ribosomal subunit protein uL5 Escherichia coli O157:H7
B7L4J7 4.68e-128 359 96 0 179 3 rplE Large ribosomal subunit protein uL5 Escherichia coli (strain 55989 / EAEC)
B7MCS3 4.68e-128 359 96 0 179 3 rplE Large ribosomal subunit protein uL5 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UK32 4.68e-128 359 96 0 179 3 rplE Large ribosomal subunit protein uL5 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSJ7 4.68e-128 359 96 0 179 3 rplE Large ribosomal subunit protein uL5 Escherichia coli O139:H28 (strain E24377A / ETEC)
Q7MYG3 4.95e-128 359 97 0 179 3 rplE Large ribosomal subunit protein uL5 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B2VK52 5.4e-128 359 96 0 179 3 rplE Large ribosomal subunit protein uL5 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B4F1J6 1.13e-127 358 96 0 179 3 rplE Large ribosomal subunit protein uL5 Proteus mirabilis (strain HI4320)
A9MN60 1.77e-127 358 96 0 179 3 rplE Large ribosomal subunit protein uL5 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A8AQK4 2.71e-127 357 96 0 179 3 rplE Large ribosomal subunit protein uL5 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A1JS20 5.84e-127 357 96 0 179 3 rplE Large ribosomal subunit protein uL5 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P62405 1.17e-126 356 95 0 179 3 rplE Large ribosomal subunit protein uL5 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P62404 1.17e-126 356 95 0 179 3 rplE Large ribosomal subunit protein uL5 Salmonella typhi
B4TXD0 1.17e-126 356 95 0 179 3 rplE Large ribosomal subunit protein uL5 Salmonella schwarzengrund (strain CVM19633)
B5BGX4 1.17e-126 356 95 0 179 3 rplE Large ribosomal subunit protein uL5 Salmonella paratyphi A (strain AKU_12601)
C0Q0A4 1.17e-126 356 95 0 179 3 rplE Large ribosomal subunit protein uL5 Salmonella paratyphi C (strain RKS4594)
A9MSY6 1.17e-126 356 95 0 179 3 rplE Large ribosomal subunit protein uL5 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PIU5 1.17e-126 356 95 0 179 3 rplE Large ribosomal subunit protein uL5 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUS8 1.17e-126 356 95 0 179 3 rplE Large ribosomal subunit protein uL5 Salmonella newport (strain SL254)
B4TKK3 1.17e-126 356 95 0 179 3 rplE Large ribosomal subunit protein uL5 Salmonella heidelberg (strain SL476)
B5RH27 1.17e-126 356 95 0 179 3 rplE Large ribosomal subunit protein uL5 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R279 1.17e-126 356 95 0 179 3 rplE Large ribosomal subunit protein uL5 Salmonella enteritidis PT4 (strain P125109)
B5FJK2 1.17e-126 356 95 0 179 3 rplE Large ribosomal subunit protein uL5 Salmonella dublin (strain CT_02021853)
Q57J44 1.17e-126 356 95 0 179 3 rplE Large ribosomal subunit protein uL5 Salmonella choleraesuis (strain SC-B67)
B5F7T3 1.17e-126 356 95 0 179 3 rplE Large ribosomal subunit protein uL5 Salmonella agona (strain SL483)
B5XNA5 1.64e-126 355 95 0 179 3 rplE Large ribosomal subunit protein uL5 Klebsiella pneumoniae (strain 342)
A4WFB6 1.25e-125 353 94 0 179 3 rplE Large ribosomal subunit protein uL5 Enterobacter sp. (strain 638)
Q2NQN4 8.43e-125 351 94 0 179 3 rplE Large ribosomal subunit protein uL5 Sodalis glossinidius (strain morsitans)
A6VLK0 9.04e-122 343 91 0 179 3 rplE Large ribosomal subunit protein uL5 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q7VKE5 1.91e-121 343 90 0 179 3 rplE Large ribosomal subunit protein uL5 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9CL42 2.25e-121 342 91 0 179 3 rplE Large ribosomal subunit protein uL5 Pasteurella multocida (strain Pm70)
Q65QW7 5.12e-121 342 90 0 179 3 rplE Large ribosomal subunit protein uL5 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B0BSU3 7.85e-121 341 89 0 179 3 rplE Large ribosomal subunit protein uL5 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZ23 7.85e-121 341 89 0 179 3 rplE Large ribosomal subunit protein uL5 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N369 7.85e-121 341 89 0 179 3 rplE Large ribosomal subunit protein uL5 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0UX26 3.49e-120 340 89 0 179 3 rplE Large ribosomal subunit protein uL5 Histophilus somni (strain 2336)
Q0I150 3.49e-120 340 89 0 179 3 rplE Large ribosomal subunit protein uL5 Histophilus somni (strain 129Pt)
B8F6Q9 5.78e-120 339 89 0 179 3 rplE Large ribosomal subunit protein uL5 Glaesserella parasuis serovar 5 (strain SH0165)
P44346 7.61e-120 338 89 0 179 3 rplE Large ribosomal subunit protein uL5 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UHU3 7.61e-120 338 89 0 179 3 rplE Large ribosomal subunit protein uL5 Haemophilus influenzae (strain PittGG)
A5UDT5 7.61e-120 338 89 0 179 3 rplE Large ribosomal subunit protein uL5 Haemophilus influenzae (strain PittEE)
Q4QMA9 7.61e-120 338 89 0 179 3 rplE Large ribosomal subunit protein uL5 Haemophilus influenzae (strain 86-028NP)
A1T0D0 1.36e-117 333 86 0 179 3 rplE Large ribosomal subunit protein uL5 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B1JIX3 6.92e-117 331 96 0 179 3 rplE Large ribosomal subunit protein uL5 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664T3 6.92e-117 331 96 0 179 3 rplE Large ribosomal subunit protein uL5 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TH04 6.92e-117 331 96 0 179 3 rplE Large ribosomal subunit protein uL5 Yersinia pestis (strain Pestoides F)
Q1CCV6 6.92e-117 331 96 0 179 3 rplE Large ribosomal subunit protein uL5 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R907 6.92e-117 331 96 0 179 3 rplE Large ribosomal subunit protein uL5 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJA0 6.92e-117 331 96 0 179 3 rplE Large ribosomal subunit protein uL5 Yersinia pestis
B2K5L8 6.92e-117 331 96 0 179 3 rplE Large ribosomal subunit protein uL5 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2V9 6.92e-117 331 96 0 179 3 rplE Large ribosomal subunit protein uL5 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNM2 6.92e-117 331 96 0 179 3 rplE Large ribosomal subunit protein uL5 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
C4L7U2 1.06e-116 331 86 0 179 3 rplE Large ribosomal subunit protein uL5 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B7VLE5 1.63e-116 330 86 0 179 3 rplE Large ribosomal subunit protein uL5 Vibrio atlanticus (strain LGP32)
A7N0I9 1.72e-116 330 86 0 179 3 rplE Large ribosomal subunit protein uL5 Vibrio campbellii (strain ATCC BAA-1116)
A4SSZ4 2.61e-116 330 86 0 179 3 rplE Large ribosomal subunit protein uL5 Aeromonas salmonicida (strain A449)
B5FG21 2.91e-116 330 87 0 179 3 rplE Large ribosomal subunit protein uL5 Aliivibrio fischeri (strain MJ11)
B6EPT7 3.15e-116 330 86 0 179 3 rplE Large ribosomal subunit protein uL5 Aliivibrio salmonicida (strain LFI1238)
A0KF33 3.22e-116 330 86 0 179 3 rplE Large ribosomal subunit protein uL5 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q6LVA4 2.98e-115 327 86 0 179 3 rplE Large ribosomal subunit protein uL5 Photobacterium profundum (strain SS9)
Q3IJJ7 5.33e-115 327 84 0 179 3 rplE Large ribosomal subunit protein uL5 Pseudoalteromonas translucida (strain TAC 125)
C3LRP6 9.54e-115 326 85 0 179 3 rplE Large ribosomal subunit protein uL5 Vibrio cholerae serotype O1 (strain M66-2)
Q9KNZ6 9.54e-115 326 85 0 179 3 rplE Large ribosomal subunit protein uL5 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F554 9.54e-115 326 85 0 179 3 rplE Large ribosomal subunit protein uL5 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q87T01 1.34e-114 325 84 0 179 3 rplE Large ribosomal subunit protein uL5 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7MPH6 5.34e-114 324 84 0 179 3 rplE Large ribosomal subunit protein uL5 Vibrio vulnificus (strain YJ016)
Q8DE51 5.34e-114 324 84 0 179 3 rplE Large ribosomal subunit protein uL5 Vibrio vulnificus (strain CMCP6)
Q5E8A2 8.17e-114 323 86 0 177 3 rplE Large ribosomal subunit protein uL5 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q83PY9 5.11e-113 322 93 0 179 3 rplE Large ribosomal subunit protein uL5 Shigella flexneri
Q5QXX0 3.13e-110 314 81 0 179 3 rplE Large ribosomal subunit protein uL5 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A1S230 9.47e-110 313 79 0 179 3 rplE Large ribosomal subunit protein uL5 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B4RT40 3.2e-109 312 79 0 179 3 rplE Large ribosomal subunit protein uL5 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B8D837 4.7e-108 309 80 0 179 3 rplE Large ribosomal subunit protein uL5 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57579 4.7e-108 309 80 0 179 3 rplE Large ribosomal subunit protein uL5 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9T5 4.7e-108 309 80 0 179 3 rplE Large ribosomal subunit protein uL5 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
C4K7A6 5.6e-108 309 79 0 179 3 rplE Large ribosomal subunit protein uL5 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A9KWB4 1.3e-107 308 77 0 179 3 rplE Large ribosomal subunit protein uL5 Shewanella baltica (strain OS195)
A6WHU0 1.3e-107 308 77 0 179 3 rplE Large ribosomal subunit protein uL5 Shewanella baltica (strain OS185)
A3DA60 1.3e-107 308 77 0 179 3 rplE Large ribosomal subunit protein uL5 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBJ3 1.3e-107 308 77 0 179 3 rplE Large ribosomal subunit protein uL5 Shewanella baltica (strain OS223)
A3Q994 6.05e-107 306 77 0 179 3 rplE Large ribosomal subunit protein uL5 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q089P2 6.61e-107 306 77 0 179 3 rplE Large ribosomal subunit protein uL5 Shewanella frigidimarina (strain NCIMB 400)
Q8EK57 8.05e-107 306 76 0 179 3 rplE Large ribosomal subunit protein uL5 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A1REC6 1.55e-106 305 76 0 179 3 rplE Large ribosomal subunit protein uL5 Shewanella sp. (strain W3-18-1)
A4YBX1 1.55e-106 305 76 0 179 3 rplE Large ribosomal subunit protein uL5 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q12SU7 2.09e-106 305 75 0 179 3 rplE Large ribosomal subunit protein uL5 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q8K962 2.11e-106 305 78 0 179 3 rplE Large ribosomal subunit protein uL5 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A0KRN6 2.14e-106 305 76 0 179 3 rplE Large ribosomal subunit protein uL5 Shewanella sp. (strain ANA-3)
Q489A1 3.08e-106 304 79 0 179 3 rplE Large ribosomal subunit protein uL5 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q0I093 5.55e-106 303 75 0 179 3 rplE Large ribosomal subunit protein uL5 Shewanella sp. (strain MR-7)
Q0HNS5 5.55e-106 303 75 0 179 3 rplE Large ribosomal subunit protein uL5 Shewanella sp. (strain MR-4)
A8GYY8 1.28e-104 300 75 0 179 3 rplE Large ribosomal subunit protein uL5 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A8G1D6 6.26e-104 298 74 0 179 3 rplE Large ribosomal subunit protein uL5 Shewanella sediminis (strain HAW-EB3)
B0TM00 1e-103 298 74 0 179 3 rplE Large ribosomal subunit protein uL5 Shewanella halifaxensis (strain HAW-EB4)
B1KMX1 1.57e-103 297 74 0 179 3 rplE Large ribosomal subunit protein uL5 Shewanella woodyi (strain ATCC 51908 / MS32)
B8CNE5 3e-103 297 73 0 179 3 rplE Large ribosomal subunit protein uL5 Shewanella piezotolerans (strain WP3 / JCM 13877)
A6W380 4.22e-103 296 75 0 179 3 rplE Large ribosomal subunit protein uL5 Marinomonas sp. (strain MWYL1)
Q1LTC6 2.15e-102 295 75 0 179 3 rplE Large ribosomal subunit protein uL5 Baumannia cicadellinicola subsp. Homalodisca coagulata
Q2S924 2.33e-102 295 74 0 179 3 rplE Large ribosomal subunit protein uL5 Hahella chejuensis (strain KCTC 2396)
Q1H4M5 2.33e-101 292 74 0 178 3 rplE Large ribosomal subunit protein uL5 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A1TYK9 2.23e-99 287 74 0 179 3 rplE Large ribosomal subunit protein uL5 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q1R0G3 8.05e-99 285 69 0 179 3 rplE Large ribosomal subunit protein uL5 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A1KB15 1.73e-98 285 70 0 178 3 rplE Large ribosomal subunit protein uL5 Azoarcus sp. (strain BH72)
Q89A78 1.11e-97 283 73 0 178 3 rplE Large ribosomal subunit protein uL5 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q7NQG4 1.68e-97 282 70 0 178 3 rplE Large ribosomal subunit protein uL5 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q8D200 8.77e-97 280 72 0 177 3 rplE Large ribosomal subunit protein uL5 Wigglesworthia glossinidia brevipalpis
Q605C4 1.91e-96 280 70 0 178 3 rplE Large ribosomal subunit protein uL5 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q493J6 2.28e-96 279 70 0 179 3 rplE Large ribosomal subunit protein uL5 Blochmanniella pennsylvanica (strain BPEN)
Q820Q9 5.72e-96 278 67 0 178 3 rplE Large ribosomal subunit protein uL5 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q2YAY5 2.3e-95 277 67 0 178 3 rplE Large ribosomal subunit protein uL5 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q9JX13 5.78e-95 276 69 0 178 3 rplE Large ribosomal subunit protein uL5 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q0AII4 8.68e-95 275 67 0 178 3 rplE Large ribosomal subunit protein uL5 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A1KRI5 8.97e-95 275 69 0 178 3 rplE Large ribosomal subunit protein uL5 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9K1I4 8.97e-95 275 69 0 178 3 rplE Large ribosomal subunit protein uL5 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A9M3V4 8.97e-95 275 69 0 178 3 rplE Large ribosomal subunit protein uL5 Neisseria meningitidis serogroup C (strain 053442)
Q5F5T9 3.69e-94 274 68 0 178 3 rplE Large ribosomal subunit protein uL5 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q3SLN7 1.39e-93 272 65 0 178 3 rplE Large ribosomal subunit protein uL5 Thiobacillus denitrificans (strain ATCC 25259)
B8GV46 1.52e-93 272 65 0 178 3 rplE Large ribosomal subunit protein uL5 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A4VHP2 1.97e-93 272 68 0 178 3 rplE Large ribosomal subunit protein uL5 Stutzerimonas stutzeri (strain A1501)
C1DKM5 3.41e-93 271 68 0 178 3 rplE Large ribosomal subunit protein uL5 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A9ADK5 4.59e-93 271 66 0 178 3 rplE Large ribosomal subunit protein uL5 Burkholderia multivorans (strain ATCC 17616 / 249)
Q13TI2 5.29e-93 271 66 0 178 3 rplE Large ribosomal subunit protein uL5 Paraburkholderia xenovorans (strain LB400)
B2T739 5.29e-93 271 66 0 178 3 rplE Large ribosomal subunit protein uL5 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
B2JI53 5.29e-93 271 66 0 178 3 rplE Large ribosomal subunit protein uL5 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q5ZYN1 7.25e-93 271 67 0 178 3 rplE Large ribosomal subunit protein uL5 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
B3R7F6 7.94e-93 270 66 0 177 3 rplE Large ribosomal subunit protein uL5 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0K631 7.94e-93 270 66 0 177 3 rplE Large ribosomal subunit protein uL5 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B0U0X7 8.11e-93 270 68 0 178 3 rplE Large ribosomal subunit protein uL5 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q47J91 8.11e-93 270 67 0 178 3 rplE Large ribosomal subunit protein uL5 Dechloromonas aromatica (strain RCB)
Q5WZK0 8.51e-93 270 67 0 178 3 rplE Large ribosomal subunit protein uL5 Legionella pneumophila (strain Lens)
A5IHQ2 8.51e-93 270 67 0 178 3 rplE Large ribosomal subunit protein uL5 Legionella pneumophila (strain Corby)
Q5X847 8.51e-93 270 67 0 178 3 rplE Large ribosomal subunit protein uL5 Legionella pneumophila (strain Paris)
B0V6V7 9.34e-93 270 68 0 178 3 rplE Large ribosomal subunit protein uL5 Acinetobacter baumannii (strain AYE)
A3M972 9.34e-93 270 68 0 178 3 rplE Large ribosomal subunit protein uL5 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VQT0 9.34e-93 270 68 0 178 3 rplE Large ribosomal subunit protein uL5 Acinetobacter baumannii (strain SDF)
B7IA27 9.34e-93 270 68 0 178 1 rplE Large ribosomal subunit protein uL5 Acinetobacter baumannii (strain AB0057)
B7GW14 9.34e-93 270 68 0 178 3 rplE Large ribosomal subunit protein uL5 Acinetobacter baumannii (strain AB307-0294)
A6UZK0 9.45e-93 270 68 0 178 3 rplE Large ribosomal subunit protein uL5 Pseudomonas aeruginosa (strain PA7)
Q9HWE7 1.2e-92 270 68 0 178 1 rplE Large ribosomal subunit protein uL5 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02T68 1.2e-92 270 68 0 178 3 rplE Large ribosomal subunit protein uL5 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V656 1.2e-92 270 68 0 178 3 rplE Large ribosomal subunit protein uL5 Pseudomonas aeruginosa (strain LESB58)
Q46WF6 1.45e-92 270 66 0 177 3 rplE Large ribosomal subunit protein uL5 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q3J8S6 1.77e-92 270 68 0 178 3 rplE Large ribosomal subunit protein uL5 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q5NHV6 1.84e-92 270 69 0 178 3 rplE Large ribosomal subunit protein uL5 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14JA8 1.84e-92 270 69 0 178 3 rplE Large ribosomal subunit protein uL5 Francisella tularensis subsp. tularensis (strain FSC 198)
A4IZS2 2.17e-92 269 69 0 178 3 rplE Large ribosomal subunit protein uL5 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q0BNR5 2.17e-92 269 69 0 178 3 rplE Large ribosomal subunit protein uL5 Francisella tularensis subsp. holarctica (strain OSU18)
A0Q4J5 2.17e-92 269 69 0 178 3 rplE Large ribosomal subunit protein uL5 Francisella tularensis subsp. novicida (strain U112)
Q2A5F8 2.17e-92 269 69 0 178 3 rplE Large ribosomal subunit protein uL5 Francisella tularensis subsp. holarctica (strain LVS)
A7N9T7 2.17e-92 269 69 0 178 3 rplE Large ribosomal subunit protein uL5 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q1BRW0 2.53e-92 269 65 0 178 3 rplE Large ribosomal subunit protein uL5 Burkholderia orbicola (strain AU 1054)
B1JU34 2.53e-92 269 65 0 178 3 rplE Large ribosomal subunit protein uL5 Burkholderia orbicola (strain MC0-3)
Q39KF5 2.53e-92 269 65 0 178 3 rplE Large ribosomal subunit protein uL5 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A0K3N7 2.53e-92 269 65 0 178 3 rplE Large ribosomal subunit protein uL5 Burkholderia cenocepacia (strain HI2424)
Q0VSJ1 2.68e-92 269 66 0 178 3 rplE Large ribosomal subunit protein uL5 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A4XZ78 2.74e-92 269 68 0 178 3 rplE Large ribosomal subunit protein uL5 Pseudomonas mendocina (strain ymp)
Q7VTB9 2.74e-92 269 64 0 178 3 rplE Large ribosomal subunit protein uL5 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W2E3 2.74e-92 269 64 0 178 3 rplE Large ribosomal subunit protein uL5 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WRB1 2.74e-92 269 64 0 178 3 rplE Large ribosomal subunit protein uL5 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q8XV24 3.53e-92 269 65 0 177 3 rplE Large ribosomal subunit protein uL5 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q5P320 3.93e-92 269 66 0 178 3 rplE Large ribosomal subunit protein uL5 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B1JAK0 5.89e-92 268 67 0 178 3 rplE Large ribosomal subunit protein uL5 Pseudomonas putida (strain W619)
B2UEK7 6.17e-92 268 66 0 177 3 rplE Large ribosomal subunit protein uL5 Ralstonia pickettii (strain 12J)
Q0BJ34 6.43e-92 268 65 0 178 3 rplE Large ribosomal subunit protein uL5 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B4E5D2 6.43e-92 268 65 0 178 3 rplE Large ribosomal subunit protein uL5 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
B1YRP1 6.43e-92 268 65 0 178 3 rplE Large ribosomal subunit protein uL5 Burkholderia ambifaria (strain MC40-6)
Q1LI49 7.85e-92 268 67 0 177 3 rplE Large ribosomal subunit protein uL5 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A4JAQ2 8.01e-92 268 65 0 178 3 rplE Large ribosomal subunit protein uL5 Burkholderia vietnamiensis (strain G4 / LMG 22486)
A6T3J2 8.65e-92 268 65 0 178 3 rplE Large ribosomal subunit protein uL5 Janthinobacterium sp. (strain Marseille)
B2SDX3 9.04e-92 268 68 0 178 3 rplE Large ribosomal subunit protein uL5 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q63Q23 1.04e-91 268 65 0 178 3 rplE Large ribosomal subunit protein uL5 Burkholderia pseudomallei (strain K96243)
A3NEG7 1.04e-91 268 65 0 178 3 rplE Large ribosomal subunit protein uL5 Burkholderia pseudomallei (strain 668)
Q3JMS5 1.04e-91 268 65 0 178 3 rplE Large ribosomal subunit protein uL5 Burkholderia pseudomallei (strain 1710b)
A3P0A1 1.04e-91 268 65 0 178 3 rplE Large ribosomal subunit protein uL5 Burkholderia pseudomallei (strain 1106a)
A1V891 1.04e-91 268 65 0 178 3 rplE Large ribosomal subunit protein uL5 Burkholderia mallei (strain SAVP1)
A2S7I8 1.04e-91 268 65 0 178 3 rplE Large ribosomal subunit protein uL5 Burkholderia mallei (strain NCTC 10229)
A3MRW6 1.04e-91 268 65 0 178 3 rplE Large ribosomal subunit protein uL5 Burkholderia mallei (strain NCTC 10247)
C5BQ73 1.05e-91 268 66 0 178 3 rplE Large ribosomal subunit protein uL5 Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q88QM3 1.07e-91 268 67 0 178 3 rplE Large ribosomal subunit protein uL5 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KK79 1.07e-91 268 67 0 178 3 rplE Large ribosomal subunit protein uL5 Pseudomonas putida (strain GB-1)
A5VXQ9 1.07e-91 268 67 0 178 3 rplE Large ribosomal subunit protein uL5 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q6F7S4 1.38e-91 267 67 0 178 3 rplE Large ribosomal subunit protein uL5 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q2L279 1.39e-91 267 64 0 178 3 rplE Large ribosomal subunit protein uL5 Bordetella avium (strain 197N)
Q2SU39 1.42e-91 267 65 0 178 3 rplE Large ribosomal subunit protein uL5 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A4G9S6 1.69e-91 267 65 0 178 3 rplE Large ribosomal subunit protein uL5 Herminiimonas arsenicoxydans
A9IHT8 1.99e-91 267 63 0 178 3 rplE Large ribosomal subunit protein uL5 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q1QDH4 2.27e-91 266 66 0 178 3 rplE Large ribosomal subunit protein uL5 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q21M46 2.7e-91 266 66 0 178 3 rplE Large ribosomal subunit protein uL5 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q1IFV4 2.73e-91 266 67 0 178 3 rplE Large ribosomal subunit protein uL5 Pseudomonas entomophila (strain L48)
Q3K600 3.08e-91 266 68 0 178 3 rplE Large ribosomal subunit protein uL5 Pseudomonas fluorescens (strain Pf0-1)
Q4K545 3.08e-91 266 68 0 178 3 rplE Large ribosomal subunit protein uL5 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q4FUE4 4.05e-91 266 65 0 178 3 rplE Large ribosomal subunit protein uL5 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q889V9 5.39e-91 266 68 0 178 3 rplE Large ribosomal subunit protein uL5 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A9NAY2 7.04e-91 266 69 0 178 3 rplE Large ribosomal subunit protein uL5 Coxiella burnetii (strain RSA 331 / Henzerling II)
A5WCK2 7.99e-91 265 67 0 178 3 rplE Large ribosomal subunit protein uL5 Psychrobacter sp. (strain PRwf-1)
Q62GL7 8.54e-91 265 64 0 178 3 rplE Large ribosomal subunit protein uL5 Burkholderia mallei (strain ATCC 23344)
Q83ER4 8.96e-91 265 69 0 178 3 rplE Large ribosomal subunit protein uL5 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9KD19 8.96e-91 265 69 0 178 3 rplE Large ribosomal subunit protein uL5 Coxiella burnetii (strain Dugway 5J108-111)
B6J251 8.96e-91 265 69 0 178 3 rplE Large ribosomal subunit protein uL5 Coxiella burnetii (strain CbuG_Q212)
B6J5E4 9.46e-91 265 69 0 178 3 rplE Large ribosomal subunit protein uL5 Coxiella burnetii (strain CbuK_Q154)
Q4ZMQ6 1.37e-90 265 67 0 178 3 rplE Large ribosomal subunit protein uL5 Pseudomonas syringae pv. syringae (strain B728a)
Q48D48 1.37e-90 265 67 0 178 3 rplE Large ribosomal subunit protein uL5 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q057B6 1.69e-90 265 64 0 179 3 rplE Large ribosomal subunit protein uL5 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q0ABG3 2.05e-90 264 66 0 179 3 rplE Large ribosomal subunit protein uL5 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B3PK49 2.7e-90 264 67 0 178 3 rplE Large ribosomal subunit protein uL5 Cellvibrio japonicus (strain Ueda107)
C3K2W4 3.05e-90 264 67 0 178 3 rplE Large ribosomal subunit protein uL5 Pseudomonas fluorescens (strain SBW25)
A1W320 3.63e-90 264 64 0 178 3 rplE Large ribosomal subunit protein uL5 Acidovorax sp. (strain JS42)
B9MBU9 3.63e-90 264 64 0 178 3 rplE Large ribosomal subunit protein uL5 Acidovorax ebreus (strain TPSY)
Q7VQD6 3.84e-90 264 69 0 178 3 rplE Large ribosomal subunit protein uL5 Blochmanniella floridana
A4SUX3 1.09e-89 263 62 0 176 3 rplE Large ribosomal subunit protein uL5 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
C5CQ88 2.55e-89 261 64 0 178 3 rplE Large ribosomal subunit protein uL5 Variovorax paradoxus (strain S110)
B7GJ79 3.75e-89 261 63 0 179 3 rplE Large ribosomal subunit protein uL5 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
A1VJ27 1.46e-88 259 62 0 178 3 rplE Large ribosomal subunit protein uL5 Polaromonas naphthalenivorans (strain CJ2)
A1TJS9 2.26e-88 259 62 0 178 3 rplE Large ribosomal subunit protein uL5 Paracidovorax citrulli (strain AAC00-1)
A1WVB0 2.55e-88 259 64 0 178 3 rplE Large ribosomal subunit protein uL5 Halorhodospira halophila (strain DSM 244 / SL1)
Q12G91 4.71e-88 258 62 0 178 3 rplE Large ribosomal subunit protein uL5 Polaromonas sp. (strain JS666 / ATCC BAA-500)
B9M6G6 5.14e-88 258 61 0 178 3 rplE Large ribosomal subunit protein uL5 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
A5GAV4 8.23e-88 258 61 0 178 3 rplE Large ribosomal subunit protein uL5 Geotalea uraniireducens (strain Rf4)
A9BRW3 1.18e-87 257 62 0 178 3 rplE Large ribosomal subunit protein uL5 Delftia acidovorans (strain DSM 14801 / SPH-1)
B1XSR3 1.2e-87 257 61 0 176 3 rplE Large ribosomal subunit protein uL5 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q31IX0 2.78e-87 256 62 0 179 3 rplE Large ribosomal subunit protein uL5 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A1WKA4 3.27e-87 256 62 0 178 3 rplE Large ribosomal subunit protein uL5 Verminephrobacter eiseniae (strain EF01-2)
Q748Z9 3.35e-87 256 62 0 178 3 rplE Large ribosomal subunit protein uL5 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B2FQJ6 4.12e-87 256 64 0 177 3 rplE Large ribosomal subunit protein uL5 Stenotrophomonas maltophilia (strain K279a)
A0L5Y5 9.74e-87 255 64 0 179 3 rplE Large ribosomal subunit protein uL5 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q8PNR4 1.07e-86 255 64 0 176 3 rplE Large ribosomal subunit protein uL5 Xanthomonas axonopodis pv. citri (strain 306)
Q5WLQ0 1.55e-86 254 61 0 179 3 rplE Large ribosomal subunit protein uL5 Shouchella clausii (strain KSM-K16)
A5EX87 1.71e-86 254 62 0 178 3 rplE Large ribosomal subunit protein uL5 Dichelobacter nodosus (strain VCS1703A)
B4SKX5 2.09e-86 254 63 0 177 3 rplE Large ribosomal subunit protein uL5 Stenotrophomonas maltophilia (strain R551-3)
C0ZIJ2 2.84e-86 254 60 0 178 3 rplE Large ribosomal subunit protein uL5 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
B1YGW2 3.09e-86 254 62 0 179 3 rplE Large ribosomal subunit protein uL5 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q81VR8 3.09e-86 254 59 0 179 3 rplE Large ribosomal subunit protein uL5 Bacillus anthracis
C3LJ94 3.09e-86 254 59 0 179 3 rplE Large ribosomal subunit protein uL5 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P9R7 3.09e-86 254 59 0 179 3 rplE Large ribosomal subunit protein uL5 Bacillus anthracis (strain A0248)
Q6HPP6 3.38e-86 254 59 0 179 3 rplE Large ribosomal subunit protein uL5 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63H78 3.38e-86 254 59 0 179 3 rplE Large ribosomal subunit protein uL5 Bacillus cereus (strain ZK / E33L)
Q81J30 3.38e-86 254 59 0 179 3 rplE Large ribosomal subunit protein uL5 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HJ60 3.38e-86 254 59 0 179 3 rplE Large ribosomal subunit protein uL5 Bacillus cereus (strain B4264)
C1ET51 3.38e-86 254 59 0 179 3 rplE Large ribosomal subunit protein uL5 Bacillus cereus (strain 03BB102)
B7JKD1 3.38e-86 254 59 0 179 3 rplE Large ribosomal subunit protein uL5 Bacillus cereus (strain AH820)
A0R8J2 3.38e-86 254 59 0 179 3 rplE Large ribosomal subunit protein uL5 Bacillus thuringiensis (strain Al Hakam)
C4KZN4 3.94e-86 253 59 0 179 3 rplE Large ribosomal subunit protein uL5 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q3BWX1 4.07e-86 253 64 0 176 3 rplE Large ribosomal subunit protein uL5 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B9IZK6 4.95e-86 253 59 0 179 3 rplE Large ribosomal subunit protein uL5 Bacillus cereus (strain Q1)
B7HQV6 4.95e-86 253 59 0 179 3 rplE Large ribosomal subunit protein uL5 Bacillus cereus (strain AH187)
Q73F84 4.95e-86 253 59 0 179 3 rplE Large ribosomal subunit protein uL5 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q8ETX1 6.1e-86 253 59 0 179 3 rplE Large ribosomal subunit protein uL5 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q5L411 1.02e-85 252 60 0 179 3 rplE Large ribosomal subunit protein uL5 Geobacillus kaustophilus (strain HTA426)
A7GK32 1.07e-85 252 59 0 179 3 rplE Large ribosomal subunit protein uL5 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q5GWU7 1.14e-85 252 63 0 176 3 rplE Large ribosomal subunit protein uL5 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SQS2 1.14e-85 252 63 0 176 3 rplE Large ribosomal subunit protein uL5 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NZZ7 1.14e-85 252 63 0 176 3 rplE Large ribosomal subunit protein uL5 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8PC39 1.22e-85 252 63 0 176 3 rplE Large ribosomal subunit protein uL5 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RU70 1.22e-85 252 63 0 176 3 rplE Large ribosomal subunit protein uL5 Xanthomonas campestris pv. campestris (strain B100)
Q4URF1 1.22e-85 252 63 0 176 3 rplE Large ribosomal subunit protein uL5 Xanthomonas campestris pv. campestris (strain 8004)
B1HMW8 1.23e-85 252 62 0 179 3 rplE Large ribosomal subunit protein uL5 Lysinibacillus sphaericus (strain C3-41)
B5EFR2 1.24e-85 252 61 0 178 3 rplE Large ribosomal subunit protein uL5 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q39XZ4 1.26e-85 252 60 0 178 3 rplE Large ribosomal subunit protein uL5 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A9VP89 1.27e-85 252 59 0 179 3 rplE Large ribosomal subunit protein uL5 Bacillus mycoides (strain KBAB4)
Q9Z9K2 1.28e-85 252 61 0 179 3 rplE Large ribosomal subunit protein uL5 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q2RQX2 1.31e-85 252 62 0 179 3 rplE Large ribosomal subunit protein uL5 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q0AUJ2 1.51e-85 252 60 0 178 3 rplE Large ribosomal subunit protein uL5 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
B7IT31 1.88e-85 252 59 0 179 3 rplE Large ribosomal subunit protein uL5 Bacillus cereus (strain G9842)
A4IJK0 2.8e-85 251 59 0 179 3 rplE Large ribosomal subunit protein uL5 Geobacillus thermodenitrificans (strain NG80-2)
Q1GPB1 3.08e-85 252 62 0 175 3 rplE Large ribosomal subunit protein uL5 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q7A083 3.52e-85 251 60 0 179 3 rplE Large ribosomal subunit protein uL5 Staphylococcus aureus (strain MW2)
A8Z345 3.52e-85 251 60 0 179 3 rplE Large ribosomal subunit protein uL5 Staphylococcus aureus (strain USA300 / TCH1516)
Q6G783 3.52e-85 251 60 0 179 3 rplE Large ribosomal subunit protein uL5 Staphylococcus aureus (strain MSSA476)
Q6GEJ5 3.52e-85 251 60 0 179 3 rplE Large ribosomal subunit protein uL5 Staphylococcus aureus (strain MRSA252)
Q7A465 3.52e-85 251 60 0 179 1 rplE Large ribosomal subunit protein uL5 Staphylococcus aureus (strain N315)
Q99S33 3.52e-85 251 60 0 179 3 rplE Large ribosomal subunit protein uL5 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJ80 3.52e-85 251 60 0 179 3 rplE Large ribosomal subunit protein uL5 Staphylococcus aureus (strain Newman)
Q5HDX0 3.52e-85 251 60 0 179 3 rplE Large ribosomal subunit protein uL5 Staphylococcus aureus (strain COL)
Q2YYK9 3.52e-85 251 60 0 179 1 rplE Large ribosomal subunit protein uL5 Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IV22 3.52e-85 251 60 0 179 3 rplE Large ribosomal subunit protein uL5 Staphylococcus aureus (strain JH9)
Q2FW18 3.52e-85 251 60 0 179 1 rplE Large ribosomal subunit protein uL5 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FEQ1 3.52e-85 251 60 0 179 3 rplE Large ribosomal subunit protein uL5 Staphylococcus aureus (strain USA300)
A6U3W3 3.52e-85 251 60 0 179 3 rplE Large ribosomal subunit protein uL5 Staphylococcus aureus (strain JH1)
A7X5E5 3.52e-85 251 60 0 179 3 rplE Large ribosomal subunit protein uL5 Staphylococcus aureus (strain Mu3 / ATCC 700698)
P08895 6.22e-85 250 59 0 179 1 rplE Large ribosomal subunit protein uL5 Geobacillus stearothermophilus
C6E4P5 7.02e-85 250 61 0 178 3 rplE Large ribosomal subunit protein uL5 Geobacter sp. (strain M21)
B9DM35 1.05e-84 250 59 0 179 3 rplE Large ribosomal subunit protein uL5 Staphylococcus carnosus (strain TM300)
B0U5L1 1.09e-84 250 62 0 178 3 rplE Large ribosomal subunit protein uL5 Xylella fastidiosa (strain M12)
Q87E70 1.16e-84 249 63 0 178 3 rplE Large ribosomal subunit protein uL5 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I8I1 1.16e-84 249 63 0 178 3 rplE Large ribosomal subunit protein uL5 Xylella fastidiosa (strain M23)
Q4L8A2 1.74e-84 249 59 0 179 3 rplE Large ribosomal subunit protein uL5 Staphylococcus haemolyticus (strain JCSC1435)
A7NR51 1.88e-84 249 62 0 178 3 rplE Large ribosomal subunit protein uL5 Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q9PE64 1.97e-84 249 62 0 178 3 rplE Large ribosomal subunit protein uL5 Xylella fastidiosa (strain 9a5c)
C5D3S9 2.29e-84 249 59 0 179 3 rplE Large ribosomal subunit protein uL5 Geobacillus sp. (strain WCH70)
A7Z0Q0 3.83e-84 248 59 0 179 3 rplE Large ribosomal subunit protein uL5 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q8CRH2 4.37e-84 248 59 0 179 3 rplE Large ribosomal subunit protein uL5 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM11 4.37e-84 248 59 0 179 3 rplE Large ribosomal subunit protein uL5 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q21QN5 6.93e-84 248 59 0 178 3 rplE Large ribosomal subunit protein uL5 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
P12877 7.9e-84 248 59 0 179 1 rplE Large ribosomal subunit protein uL5 Bacillus subtilis (strain 168)
Q38US4 8.44e-84 248 61 0 177 3 rplE Large ribosomal subunit protein uL5 Latilactobacillus sakei subsp. sakei (strain 23K)
A0ALV6 8.62e-84 248 59 0 179 3 rplE Large ribosomal subunit protein uL5 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q927L9 8.62e-84 248 59 0 179 1 rplE Large ribosomal subunit protein uL5 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DB20 8.62e-84 248 59 0 179 3 rplE Large ribosomal subunit protein uL5 Listeria monocytogenes serotype 4a (strain HCC23)
Q71WF8 8.62e-84 248 59 0 179 3 rplE Large ribosomal subunit protein uL5 Listeria monocytogenes serotype 4b (strain F2365)
C1KZG8 8.62e-84 248 59 0 179 3 rplE Large ribosomal subunit protein uL5 Listeria monocytogenes serotype 4b (strain CLIP80459)
Q7ANU7 8.62e-84 248 59 0 179 3 rplE Large ribosomal subunit protein uL5 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A0LIK2 1.03e-83 247 58 0 179 3 rplE Large ribosomal subunit protein uL5 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q5M2C5 1.43e-83 247 61 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXS3 1.43e-83 247 61 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus thermophilus (strain CNRZ 1066)
B3E7U7 1.66e-83 247 57 0 178 3 rplE Large ribosomal subunit protein uL5 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B9E9K3 2.09e-83 246 56 0 179 3 rplE Large ribosomal subunit protein uL5 Macrococcus caseolyticus (strain JCSC5402)
Q49ZF6 3.91e-83 246 59 0 179 3 rplE Large ribosomal subunit protein uL5 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
C1CPA0 4.51e-83 246 62 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CIA9 4.51e-83 246 62 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus pneumoniae (strain P1031)
C1CC18 4.51e-83 246 62 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus pneumoniae (strain JJA)
Q8CWV4 4.51e-83 246 62 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IS52 4.51e-83 246 62 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus pneumoniae (strain CGSP14)
Q97SV1 4.51e-83 246 62 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZKG9 4.51e-83 246 62 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1I8L0 4.51e-83 246 62 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus pneumoniae (strain Hungary19A-6)
C1CAM4 4.51e-83 246 62 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus pneumoniae (strain 70585)
B5E6G7 4.51e-83 246 62 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus pneumoniae serotype 19F (strain G54)
Q04MM4 4.51e-83 246 62 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
B5XJ48 5.93e-83 245 62 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus pyogenes serotype M49 (strain NZ131)
Q8E2C2 9.09e-83 245 62 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E7S9 9.09e-83 245 62 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus agalactiae serotype III (strain NEM316)
Q3K3V7 9.09e-83 245 62 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q2RFQ9 1.06e-82 245 59 0 179 3 rplE Large ribosomal subunit protein uL5 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q03IG3 1.33e-82 244 61 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q2G8W8 1.42e-82 245 62 0 175 3 rplE Large ribosomal subunit protein uL5 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
C0MCC2 2e-82 244 61 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus equi subsp. zooepidemicus (strain H70)
B4U512 2e-82 244 61 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0M9H3 2e-82 244 61 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus equi subsp. equi (strain 4047)
Q839F2 2.57e-82 244 58 0 179 1 rplE Large ribosomal subunit protein uL5 Enterococcus faecalis (strain ATCC 700802 / V583)
Q03EC8 2.66e-82 244 59 0 177 3 rplE Large ribosomal subunit protein uL5 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q02W36 2.84e-82 244 61 0 177 3 rplE Large ribosomal subunit protein uL5 Lactococcus lactis subsp. cremoris (strain SK11)
A2RNP3 2.84e-82 244 61 0 177 1 rplE Large ribosomal subunit protein uL5 Lactococcus lactis subsp. cremoris (strain MG1363)
Q9CDX4 2.84e-82 244 61 0 177 3 rplE Large ribosomal subunit protein uL5 Lactococcus lactis subsp. lactis (strain IL1403)
Q7NEG4 2.84e-82 244 59 0 177 3 rplE Large ribosomal subunit protein uL5 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
A9NEE5 3.24e-82 244 58 0 178 3 rplE Large ribosomal subunit protein uL5 Acholeplasma laidlawii (strain PG-8A)
P0DE57 3.57e-82 243 61 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48VT7 3.57e-82 243 61 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RC26 3.57e-82 243 61 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J901 3.57e-82 243 61 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JJ50 3.57e-82 243 61 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JP05 3.57e-82 243 61 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JE46 3.57e-82 243 61 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q7CNP5 3.57e-82 243 61 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XEC3 3.57e-82 243 61 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DE56 3.57e-82 243 61 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q9A1W2 3.57e-82 243 61 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus pyogenes serotype M1
Q65P95 4.03e-82 243 58 0 179 3 rplE Large ribosomal subunit protein uL5 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q98N45 4.74e-82 244 62 0 177 3 rplE Large ribosomal subunit protein uL5 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
O67568 6.08e-82 243 61 0 178 3 rplE Large ribosomal subunit protein uL5 Aquifex aeolicus (strain VF5)
A4VSG6 1.95e-81 241 60 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus suis (strain 05ZYH33)
A4VYQ5 1.95e-81 241 60 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus suis (strain 98HAH33)
A0PXV8 2.06e-81 241 61 0 177 3 rplE Large ribosomal subunit protein uL5 Clostridium novyi (strain NT)
Q6AP59 2.2e-81 241 56 0 179 3 rplE Large ribosomal subunit protein uL5 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q11HR4 2.49e-81 241 60 0 177 3 rplE Large ribosomal subunit protein uL5 Chelativorans sp. (strain BNC1)
Q8DS25 2.89e-81 241 60 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
A8F997 3.23e-81 241 57 0 179 3 rplE Large ribosomal subunit protein uL5 Bacillus pumilus (strain SAFR-032)
C5CC50 3.87e-81 241 61 0 176 3 rplE Large ribosomal subunit protein uL5 Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
Q034Z5 3.93e-81 241 59 0 177 3 rplE Large ribosomal subunit protein uL5 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WAK5 3.93e-81 241 59 0 177 3 rplE Large ribosomal subunit protein uL5 Lacticaseibacillus casei (strain BL23)
Q8YPJ1 4.16e-81 241 59 0 177 3 rplE Large ribosomal subunit protein uL5 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
B1W3Z5 4.26e-81 241 61 0 177 3 rplE Large ribosomal subunit protein uL5 Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q3MFA9 6.04e-81 240 59 0 177 3 rplE Large ribosomal subunit protein uL5 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
A1ALV3 6.43e-81 240 56 0 178 3 rplE Large ribosomal subunit protein uL5 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q1AU41 6.8e-81 240 62 0 178 3 rplE Large ribosomal subunit protein uL5 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
A1AVL2 9.44e-81 240 60 0 178 3 rplE Large ribosomal subunit protein uL5 Ruthia magnifica subsp. Calyptogena magnifica
Q250M0 9.54e-81 240 56 0 179 3 rplE Large ribosomal subunit protein uL5 Desulfitobacterium hafniense (strain Y51)
B7KHZ9 9.65e-81 240 59 0 177 3 rplE Large ribosomal subunit protein uL5 Gloeothece citriformis (strain PCC 7424)
B9DSW2 1.21e-80 239 59 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
P33098 1.22e-80 240 60 0 176 3 rplE Large ribosomal subunit protein uL5 Micrococcus luteus
B8G1X8 1.53e-80 239 56 0 179 3 rplE Large ribosomal subunit protein uL5 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
A7IPQ8 1.89e-80 239 59 0 177 3 rplE Large ribosomal subunit protein uL5 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
A3CK75 1.97e-80 239 60 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus sanguinis (strain SK36)
A4J123 2.27e-80 239 59 0 179 3 rplE Large ribosomal subunit protein uL5 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q5FTZ5 2.54e-80 239 62 1 178 3 rplE Large ribosomal subunit protein uL5 Gluconobacter oxydans (strain 621H)
Q3A9S8 2.79e-80 239 58 0 179 3 rplE Large ribosomal subunit protein uL5 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
A8AZL3 3.05e-80 239 60 0 177 3 rplE Large ribosomal subunit protein uL5 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q74L78 3.25e-80 238 58 0 176 3 rplE Large ribosomal subunit protein uL5 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q8UE30 4.48e-80 238 61 0 176 3 rplE Large ribosomal subunit protein uL5 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8R7W6 4.52e-80 238 59 0 179 3 rplE Large ribosomal subunit protein uL5 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q04C03 6.14e-80 238 60 0 172 3 rplE Large ribosomal subunit protein uL5 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GBK6 6.14e-80 238 60 0 172 3 rplE Large ribosomal subunit protein uL5 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
A8ZV69 6.34e-80 238 56 0 178 3 rplE Large ribosomal subunit protein uL5 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q110B9 6.42e-80 238 58 0 175 3 rplE Large ribosomal subunit protein uL5 Trichodesmium erythraeum (strain IMS101)
Q8G085 6.95e-80 238 59 0 179 3 rplE Large ribosomal subunit protein uL5 Brucella suis biovar 1 (strain 1330)
B0CH20 6.95e-80 238 59 0 179 3 rplE Large ribosomal subunit protein uL5 Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VQZ4 6.95e-80 238 59 0 179 3 rplE Large ribosomal subunit protein uL5 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YHM8 6.95e-80 238 59 0 179 3 rplE Large ribosomal subunit protein uL5 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RJI9 6.95e-80 238 59 0 179 3 rplE Large ribosomal subunit protein uL5 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M5N8 6.95e-80 238 59 0 179 3 rplE Large ribosomal subunit protein uL5 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57CS0 6.95e-80 238 59 0 179 3 rplE Large ribosomal subunit protein uL5 Brucella abortus biovar 1 (strain 9-941)
B2S667 6.95e-80 238 59 0 179 3 rplE Large ribosomal subunit protein uL5 Brucella abortus (strain S19)
B0K5Q5 8.25e-80 238 58 0 179 3 rplE Large ribosomal subunit protein uL5 Thermoanaerobacter sp. (strain X514)
B0KCL2 8.25e-80 238 58 0 179 3 rplE Large ribosomal subunit protein uL5 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q88XX4 1.09e-79 237 59 0 177 3 rplE Large ribosomal subunit protein uL5 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
B2G8W6 1.34e-79 237 58 0 177 3 rplE Large ribosomal subunit protein uL5 Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VLJ3 1.34e-79 237 58 0 177 3 rplE Large ribosomal subunit protein uL5 Limosilactobacillus reuteri (strain DSM 20016)
A7HBN0 1.37e-79 237 57 0 178 3 rplE Large ribosomal subunit protein uL5 Anaeromyxobacter sp. (strain Fw109-5)
Q046B3 1.4e-79 237 57 0 176 3 rplE Large ribosomal subunit protein uL5 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
A8IAQ3 1.84e-79 237 59 0 177 3 rplE Large ribosomal subunit protein uL5 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q03ZN3 1.94e-79 236 59 0 176 3 rplE Large ribosomal subunit protein uL5 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q2LQA8 2.14e-79 236 58 0 178 3 rplE Large ribosomal subunit protein uL5 Syntrophus aciditrophicus (strain SB)
Q890P8 2.44e-79 236 57 0 177 3 rplE Large ribosomal subunit protein uL5 Clostridium tetani (strain Massachusetts / E88)
Q1IX84 2.49e-79 236 60 0 179 3 rplE Large ribosomal subunit protein uL5 Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
B8I7Z1 2.69e-79 236 58 0 177 3 rplE Large ribosomal subunit protein uL5 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q9RXJ0 2.94e-79 236 59 0 179 1 rplE Large ribosomal subunit protein uL5 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q2YRA7 2.98e-79 236 58 0 179 3 rplE Large ribosomal subunit protein uL5 Brucella abortus (strain 2308)
Q134U1 3.01e-79 236 58 0 179 3 rplE Large ribosomal subunit protein uL5 Rhodopseudomonas palustris (strain BisB5)
B3EP49 3.23e-79 236 60 0 178 3 rplE Large ribosomal subunit protein uL5 Chlorobium phaeobacteroides (strain BS1)
Q01WA4 3.74e-79 236 57 0 178 3 rplE Large ribosomal subunit protein uL5 Solibacter usitatus (strain Ellin6076)
B4UBB1 3.95e-79 236 57 0 178 3 rplE Large ribosomal subunit protein uL5 Anaeromyxobacter sp. (strain K)
Q2IJ79 3.95e-79 236 57 0 178 3 rplE Large ribosomal subunit protein uL5 Anaeromyxobacter dehalogenans (strain 2CP-C)
B8J872 3.95e-79 236 57 0 178 3 rplE Large ribosomal subunit protein uL5 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q8DMM0 4.22e-79 236 56 0 177 3 rplE Large ribosomal subunit protein uL5 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q07KN0 4.23e-79 236 59 0 177 3 rplE Large ribosomal subunit protein uL5 Rhodopseudomonas palustris (strain BisA53)
Q03PW9 4.71e-79 236 57 0 176 3 rplE Large ribosomal subunit protein uL5 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q1WSA2 4.81e-79 236 56 0 177 3 rplE Large ribosomal subunit protein uL5 Ligilactobacillus salivarius (strain UCC118)
Q6G2X7 6e-79 236 59 0 176 3 rplE Large ribosomal subunit protein uL5 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
B4R8M9 7.32e-79 235 58 0 175 3 rplE Large ribosomal subunit protein uL5 Phenylobacterium zucineum (strain HLK1)
Q1RHN3 7.53e-79 235 56 0 177 3 rplE Large ribosomal subunit protein uL5 Rickettsia bellii (strain RML369-C)
A8GVC6 7.53e-79 235 56 0 177 3 rplE Large ribosomal subunit protein uL5 Rickettsia bellii (strain OSU 85-389)
B0JHZ1 7.7e-79 235 57 0 176 3 rplE Large ribosomal subunit protein uL5 Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
A9WSU5 8.1e-79 235 59 0 176 3 rplE Large ribosomal subunit protein uL5 Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
B2ITP3 9.71e-79 235 57 0 177 3 rplE Large ribosomal subunit protein uL5 Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
B2GJ05 1.03e-78 235 60 0 171 3 rplE Large ribosomal subunit protein uL5 Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
B8HCZ4 1.14e-78 235 59 0 178 3 rplE Large ribosomal subunit protein uL5 Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
A0JZ72 1.14e-78 235 58 0 178 3 rplE Large ribosomal subunit protein uL5 Arthrobacter sp. (strain FB24)
A7HWS3 1.35e-78 234 58 0 179 3 rplE Large ribosomal subunit protein uL5 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
B0TC68 1.55e-78 234 56 0 178 3 rplE Large ribosomal subunit protein uL5 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
C4ZBT1 1.75e-78 234 55 0 179 3 rplE Large ribosomal subunit protein uL5 Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
B1MW02 2.46e-78 234 57 0 176 3 rplE Large ribosomal subunit protein uL5 Leuconostoc citreum (strain KM20)
A6X0D0 2.78e-78 234 58 0 179 3 rplE Large ribosomal subunit protein uL5 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q211G0 3.42e-78 234 57 0 179 3 rplE Large ribosomal subunit protein uL5 Rhodopseudomonas palustris (strain BisB18)
B1KSL3 4.35e-78 233 57 0 177 3 rplE Large ribosomal subunit protein uL5 Clostridium botulinum (strain Loch Maree / Type A3)
A6TWH0 4.39e-78 233 58 0 179 3 rplE Large ribosomal subunit protein uL5 Alkaliphilus metalliredigens (strain QYMF)
B7K236 4.59e-78 233 57 0 176 3 rplE Large ribosomal subunit protein uL5 Rippkaea orientalis (strain PCC 8801 / RF-1)
Q5FM78 4.9e-78 233 59 0 174 3 rplE Large ribosomal subunit protein uL5 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q67JV5 5.07e-78 233 61 0 177 3 rplE Large ribosomal subunit protein uL5 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
A1R8T3 5.14e-78 233 58 0 178 3 rplE Large ribosomal subunit protein uL5 Paenarthrobacter aurescens (strain TC1)
Q97EJ0 5.35e-78 233 56 0 175 3 rplE Large ribosomal subunit protein uL5 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q2W2K3 6.37e-78 233 59 0 177 3 rplE Large ribosomal subunit protein uL5 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
B3QBW8 6.97e-78 233 58 0 179 3 rplE Large ribosomal subunit protein uL5 Rhodopseudomonas palustris (strain TIE-1)
Q6N4U5 6.97e-78 233 58 0 179 1 rplE Large ribosomal subunit protein uL5 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q82DN3 8.04e-78 233 59 0 177 3 rplE Large ribosomal subunit protein uL5 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A9IW11 8.04e-78 233 57 0 178 3 rplE Large ribosomal subunit protein uL5 Bartonella tribocorum (strain CIP 105476 / IBS 506)
B1XJS7 8.11e-78 233 55 0 177 3 rplE Large ribosomal subunit protein uL5 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
B2GDV7 9.35e-78 232 59 0 177 3 rplE Large ribosomal subunit protein uL5 Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q89J96 1.08e-77 232 57 0 177 3 rplE Large ribosomal subunit protein uL5 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A7GJ62 1.11e-77 232 57 0 177 3 rplE Large ribosomal subunit protein uL5 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IGE2 1.11e-77 232 57 0 177 3 rplE Large ribosomal subunit protein uL5 Clostridium botulinum (strain Okra / Type B1)
C1FMT9 1.11e-77 232 57 0 177 3 rplE Large ribosomal subunit protein uL5 Clostridium botulinum (strain Kyoto / Type A2)
A5I7J4 1.11e-77 232 57 0 177 3 rplE Large ribosomal subunit protein uL5 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
C3KVN9 1.11e-77 232 57 0 177 3 rplE Large ribosomal subunit protein uL5 Clostridium botulinum (strain 657 / Type Ba4)
A7FZ57 1.11e-77 232 57 0 177 3 rplE Large ribosomal subunit protein uL5 Clostridium botulinum (strain ATCC 19397 / Type A)
B2TII7 1.5e-77 232 55 0 177 3 rplE Large ribosomal subunit protein uL5 Clostridium botulinum (strain Eklund 17B / Type B)
B2UYC2 1.5e-77 232 55 0 177 3 rplE Large ribosomal subunit protein uL5 Clostridium botulinum (strain Alaska E43 / Type E3)
Q0SQF6 1.51e-77 232 57 0 177 3 rplE Large ribosomal subunit protein uL5 Clostridium perfringens (strain SM101 / Type A)
Q8XHT5 1.51e-77 232 57 0 177 3 rplE Large ribosomal subunit protein uL5 Clostridium perfringens (strain 13 / Type A)
Q0TMQ8 1.51e-77 232 57 0 177 3 rplE Large ribosomal subunit protein uL5 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q2IXP8 1.58e-77 232 58 0 177 3 rplE Large ribosomal subunit protein uL5 Rhodopseudomonas palustris (strain HaA2)
B8FES3 1.65e-77 231 55 0 179 3 rplE Large ribosomal subunit protein uL5 Desulfatibacillum aliphaticivorans
A6LPS3 1.76e-77 231 56 0 177 3 rplE Large ribosomal subunit protein uL5 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
P73308 2.17e-77 231 55 0 176 3 rplE Large ribosomal subunit protein uL5 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A0QL00 2.3e-77 231 59 0 177 3 rplE Large ribosomal subunit protein uL5 Mycobacterium avium (strain 104)
A9KJI2 2.45e-77 231 56 0 179 3 rplE Large ribosomal subunit protein uL5 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
A8EZK4 2.53e-77 231 54 0 177 3 rplE Large ribosomal subunit protein uL5 Rickettsia canadensis (strain McKiel)
Q3AW81 3.15e-77 231 58 0 175 3 rplE Large ribosomal subunit protein uL5 Synechococcus sp. (strain CC9902)
Q47LK5 3.16e-77 231 58 0 179 3 rplE Large ribosomal subunit protein uL5 Thermobifida fusca (strain YX)
A6W5V0 3.73e-77 231 62 0 179 3 rplE Large ribosomal subunit protein uL5 Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
Q4UMR7 4.23e-77 231 54 0 177 3 rplE Large ribosomal subunit protein uL5 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A5CXL6 4.42e-77 231 55 0 178 3 rplE Large ribosomal subunit protein uL5 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q5NQ53 6.1e-77 231 56 0 177 3 rplE Large ribosomal subunit protein uL5 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_18535
Feature type CDS
Gene rplE
Product 50S ribosomal protein L5
Location 17040 - 17579 (strand: -1)
Length 540 (nucleotides) / 179 (amino acids)

Contig

Accession ZDB_706
Length 24827 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2387
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00281 Ribosomal protein L5
PF00673 ribosomal L5P family C-terminus

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0094 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L5

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02931 large subunit ribosomal protein L5 Ribosome -

Protein Sequence

MAKLHDYYKDEVVKQLMTQFNYNSVMQVPRVEKITLNMGVGEAIADKKLLDNAAADLAAISGQKPLITKARKSVAGFKIRQGYPIGCKVTLRGERMWEFFERLISIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTAKSDDEGRALLSAFNFPFRK

Flanking regions ( +/- flanking 50bp)

GTTTCTTCAAGTCTAACAGCGAAACTATCAAGTAATTTTTGGAGTATACGATGGCGAAACTGCATGATTACTACAAAGACGAAGTAGTTAAACAACTGATGACTCAGTTTAACTACAATTCTGTCATGCAAGTCCCTCGGGTCGAGAAGATCACCCTGAATATGGGTGTTGGTGAAGCAATTGCTGATAAAAAACTGCTGGATAACGCAGCAGCTGACTTAGCAGCAATCTCTGGTCAGAAACCATTGATCACCAAAGCACGCAAATCTGTTGCAGGCTTCAAAATCCGCCAGGGCTATCCAATCGGCTGTAAAGTAACTCTGCGTGGCGAACGCATGTGGGAGTTCTTTGAGCGACTGATTTCTATTGCTGTACCACGTATTCGTGACTTCCGTGGCTTGTCCGCTAAGTCTTTCGATGGTCGCGGTAACTACAGCATGGGCGTACGTGAACAAATCATCTTCCCTGAAATCGATTACGATAAAGTGGATCGTGTTCGTGGTCTTGATATTACTATCACTACCACCGCGAAATCTGATGATGAAGGTCGCGCACTGTTATCAGCGTTTAACTTCCCGTTTCGCAAGTAAGGCAGGGTATTCATGGCTAAGAAATCTATGAAAGCACGTGATGTAAAACG