Homologs in group_2264

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17420 FBDBKF_17420 100.0 Morganella morganii S1 ahpC Alkyl hydroperoxide reductase subunit AhpC (peroxiredoxin)
EHELCC_17315 EHELCC_17315 100.0 Morganella morganii S2 ahpC Alkyl hydroperoxide reductase subunit AhpC (peroxiredoxin)
NLDBIP_17880 NLDBIP_17880 100.0 Morganella morganii S4 ahpC Alkyl hydroperoxide reductase subunit AhpC (peroxiredoxin)
LHKJJB_17800 LHKJJB_17800 100.0 Morganella morganii S3 ahpC Alkyl hydroperoxide reductase subunit AhpC (peroxiredoxin)
F4V73_RS16595 F4V73_RS16595 93.5 Morganella psychrotolerans - peroxiredoxin C
PMI_RS00350 PMI_RS00350 85.0 Proteus mirabilis HI4320 - peroxiredoxin C

Distribution of the homologs in the orthogroup group_2264

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2264

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8K9W0 1.38e-93 274 58 0 195 3 BUsg_176 Alkyl hydroperoxide reductase C Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57279 7.2e-92 270 57 0 197 3 BU182 Alkyl hydroperoxide reductase C Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q89AS1 3.81e-88 260 54 0 199 3 bbp_171 Alkyl hydroperoxide reductase C Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P21762 8.13e-86 254 61 1 199 1 ahpC Alkyl hydroperoxide reductase C Helicobacter pylori (strain ATCC 700392 / 26695)
P56876 9.96e-85 251 60 1 199 1 ahpC Alkyl hydroperoxide reductase C Helicobacter pylori (strain J99 / ATCC 700824)
Q96468 1.37e-60 191 43 1 193 2 BAS1 2-Cys peroxiredoxin BAS1, chloroplastic (Fragment) Hordeum vulgare
P80602 2.29e-60 190 43 1 193 1 TSA 2-Cys peroxiredoxin BAS1, chloroplastic (Fragment) Triticum aestivum
P0CB50 2.15e-59 187 44 2 194 1 PRDX1 Peroxiredoxin-1 Gallus gallus
Q6ER94 3.05e-59 189 44 2 192 1 BAS1 2-Cys peroxiredoxin BAS1, chloroplastic Oryza sativa subsp. japonica
Q61171 7.14e-59 186 44 2 194 1 Prdx2 Peroxiredoxin-2 Mus musculus
Q5E947 7.37e-59 186 45 2 193 2 PRDX1 Peroxiredoxin-1 Bos taurus
Q8T6C4 8.37e-59 186 44 3 193 2 TPX Thioredoxin peroxidase Echinococcus granulosus
Q06830 9.26e-59 186 46 2 189 1 PRDX1 Peroxiredoxin-1 Homo sapiens
Q9C5R8 1.5e-58 187 45 2 188 2 At5g06290 2-Cys peroxiredoxin BAS1-like, chloroplastic Arabidopsis thaliana
Q9JKY1 1.56e-58 185 45 2 189 1 PRDX1 Peroxiredoxin-1 Cricetulus griseus
Q6B4U9 1.65e-58 185 46 2 189 1 PRDX1 Peroxiredoxin-1 Myotis lucifugus
Q8K3U7 1.9e-58 185 43 2 194 2 PRDX2 Peroxiredoxin-2 Cricetulus griseus
Q2PFZ3 2.37e-58 184 44 2 194 2 PRDX2 Peroxiredoxin-2 Macaca fascicularis
P32119 2.37e-58 184 44 2 194 1 PRDX2 Peroxiredoxin-2 Homo sapiens
A0A2Z5VKM8 2.38e-58 184 45 3 188 1 None 2-cysteine peroxiredoxin, chloroplastic Chattonella marina var. antiqua
Q63716 2.39e-58 184 45 2 189 1 Prdx1 Peroxiredoxin-1 Rattus norvegicus
P35700 4.03e-58 184 44 2 189 1 Prdx1 Peroxiredoxin-1 Mus musculus
P35704 8.66e-58 183 43 2 194 1 Prdx2 Peroxiredoxin-2 Rattus norvegicus
Q6DV14 1.34e-57 182 43 2 193 2 PRDX1 Peroxiredoxin-1 Gekko japonicus
Q555L5 5.4e-57 183 44 3 193 1 prdx4 Peroxiredoxin-4 Dictyostelium discoideum
Q26695 5.4e-57 181 47 2 186 2 None Thioredoxin peroxidase Trypanosoma brucei rhodesiense
O08807 1.4e-56 182 44 3 192 1 Prdx4 Peroxiredoxin-4 Mus musculus
Q9Z0V5 1.95e-56 182 44 3 192 2 Prdx4 Peroxiredoxin-4 Rattus norvegicus
P20108 2.35e-56 181 45 3 196 1 Prdx3 Thioredoxin-dependent peroxide reductase, mitochondrial Mus musculus
Q9NL98 6.66e-56 178 45 3 194 2 None Peroxiredoxin Ascaris suum
Q9Z0V6 1.32e-55 179 44 3 196 1 Prdx3 Thioredoxin-dependent peroxide reductase, mitochondrial Rattus norvegicus
Q90384 1.8e-55 177 43 2 193 2 None Peroxiredoxin Cynops pyrrhogaster
Q96291 2.89e-55 179 44 2 186 1 BAS1 2-Cys peroxiredoxin BAS1, chloroplastic Arabidopsis thaliana
Q13162 3.3e-55 179 43 3 192 1 PRDX4 Peroxiredoxin-4 Homo sapiens
Q9BGI3 3.54e-55 176 42 2 194 2 PRDX2 Peroxiredoxin-2 Bos taurus
O24364 8.48e-55 178 43 1 185 2 BAS1 2-Cys peroxiredoxin BAS1, chloroplastic Spinacia oleracea
P30048 9.66e-55 177 44 3 192 1 PRDX3 Thioredoxin-dependent peroxide reductase, mitochondrial Homo sapiens
Q55624 2.51e-54 174 42 3 192 3 sll0755 Putative peroxiredoxin sll0755 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9BGI2 2.58e-54 177 43 3 192 2 PRDX4 Peroxiredoxin-4 Bos taurus
Q9Y7F0 2.76e-54 174 42 2 193 2 TSA1 Peroxiredoxin TSA1-A Candida albicans (strain SC5314 / ATCC MYA-2876)
P0CU34 2.76e-54 174 42 2 193 2 TSA1B Peroxiredoxin TSA1-B Candida albicans (strain SC5314 / ATCC MYA-2876)
Q5REY3 4.37e-54 176 44 3 192 2 PRDX3 Thioredoxin-dependent peroxide reductase, mitochondrial Pongo abelii
Q9VEJ0 4.74e-54 175 43 2 185 1 Prx3 Thioredoxin-dependent peroxide reductase, mitochondrial Drosophila melanogaster
Q9V3P0 1.22e-53 172 42 3 197 1 Prx2 Peroxiredoxin 2 Drosophila melanogaster
O74887 2.95e-53 171 45 3 181 1 tpx1 Peroxiredoxin tpx1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q91191 3.9e-53 171 45 3 190 2 None Peroxiredoxin Oncorhynchus mykiss
A0A0K3AUJ9 8.7e-53 171 44 3 194 1 prdx-2 Peroxiredoxin prdx-2 Caenorhabditis elegans
P35705 9.47e-53 172 43 3 196 1 PRDX3 Thioredoxin-dependent peroxide reductase, mitochondrial Bos taurus
P34760 1.24e-51 167 45 2 175 1 TSA1 Peroxiredoxin TSA1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q5RC63 1.61e-51 166 47 2 166 2 PRDX2 Peroxiredoxin-2 Pongo abelii
Q1XDL4 5.89e-51 166 43 4 186 3 ycf42 Putative peroxiredoxin ycf42 Neopyropia yezoensis
Q21824 6.23e-51 167 45 2 170 3 prdx-3 Probable peroxiredoxin prdx-3 Caenorhabditis elegans
P48822 8.65e-51 166 43 4 193 2 TSA1 Peroxiredoxin 1 Brugia malayi
P51272 1.84e-50 164 42 4 184 3 ycf42 Putative peroxiredoxin ycf42 Porphyra purpurea
Q17172 2.64e-50 164 42 3 194 2 tsa-2 Peroxiredoxin 2 Brugia malayi
Q04120 6.88e-48 158 39 2 191 1 TSA2 Peroxiredoxin TSA2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O34564 1.19e-47 157 43 3 181 3 ykuU Putative peroxiredoxin YkuU Bacillus subtilis (strain 168)
P91883 2.81e-47 156 40 2 188 2 None Thioredoxin peroxidase Fasciola hepatica
P19476 1.52e-46 155 37 2 190 1 None Putative peroxiredoxin Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
P23161 5.05e-46 152 39 2 180 3 None Putative peroxiredoxin in rubredoxin operon Clostridium pasteurianum
P52552 1.42e-42 142 49 0 127 2 PRDX2 Peroxiredoxin-2 (Fragment) Sus scrofa
Q9L3Q5 4.91e-41 140 39 4 201 1 prxU Selenocysteine-containing peroxiredoxin PrxU Peptoclostridium acidaminophilum
Q979N7 4.52e-40 138 36 2 196 3 TV1123 Peroxiredoxin Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
Q9HJL3 9.61e-39 135 36 2 191 3 Ta0954 Peroxiredoxin 2 Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
A0R1V9 1.54e-36 129 38 5 193 1 MSMEG_4891 Alkyl hydroperoxide reductase C Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q02UU0 8.07e-36 127 34 4 186 1 ahpC Alkyl hydroperoxide reductase C Pseudomonas aeruginosa (strain UCBPP-PA14)
K0J4Q8 2.39e-35 125 40 2 155 1 ahpC Alkyl hydroperoxide reductase C Amphibacillus xylanus (strain ATCC 51415 / DSM 6626 / JCM 7361 / LMG 17667 / NBRC 15112 / Ep01)
P80239 2.46e-35 125 37 4 186 1 ahpC Alkyl hydroperoxide reductase C Bacillus subtilis (strain 168)
Q4L376 3.71e-35 125 39 2 153 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus haemolyticus (strain JCSC1435)
Q49UT8 1.49e-34 124 36 4 185 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q6L140 2.62e-34 123 36 2 194 3 PTO0727 Peroxiredoxin 2 Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
P9WQB7 2.86e-34 123 42 3 151 1 ahpC Alkyl hydroperoxide reductase C Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQB6 2.86e-34 123 42 3 151 3 ahpC Alkyl hydroperoxide reductase C Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8CMQ2 1.24e-33 121 34 4 186 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P0A0B6 1.62e-33 121 35 4 186 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain MW2)
Q6GC91 1.62e-33 121 35 4 186 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain MSSA476)
Q6GJR7 1.62e-33 121 35 4 186 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain MRSA252)
P99074 1.62e-33 121 35 4 186 1 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain N315)
P0A0B5 1.62e-33 121 35 4 186 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HIR5 1.62e-33 121 35 4 186 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain COL)
Q2YVK2 1.62e-33 121 35 4 186 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain bovine RF122 / ET3-1)
P0A0B7 1.62e-33 121 35 4 186 1 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJN4 1.62e-33 121 35 4 186 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus aureus (strain USA300)
Q5HRY1 1.71e-33 121 34 4 186 3 ahpC Alkyl hydroperoxide reductase C Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P49537 4.83e-33 120 29 3 184 3 ycf42 Putative peroxiredoxin ycf42 Trieres chinensis
P0AE11 7.81e-33 119 35 4 186 3 ahpC Alkyl hydroperoxide reductase C Shigella flexneri
P0AE08 7.81e-33 119 35 4 186 1 ahpC Alkyl hydroperoxide reductase C Escherichia coli (strain K12)
P0AE09 7.81e-33 119 35 4 186 3 ahpC Alkyl hydroperoxide reductase C Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AE10 7.81e-33 119 35 4 186 3 ahpC Alkyl hydroperoxide reductase C Escherichia coli O157:H7
P0A251 1.15e-32 119 35 4 186 1 ahpC Alkyl hydroperoxide reductase C Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A252 1.15e-32 119 35 4 186 3 ahpC Alkyl hydroperoxide reductase C Salmonella typhi
Q8SS85 1.93e-32 118 35 2 157 1 ECU03_1190 Putative thioredoxin peroxidase Encephalitozoon cuniculi (strain GB-M1)
O67024 5.36e-32 118 38 3 170 1 aq_858 Peroxiredoxin Aquifex aeolicus (strain VF5)
P26830 3.39e-31 114 34 2 158 3 None Alkyl hydroperoxide reductase C (Fragment) Ferdinandcohnia aciditolerans (strain JCM 32973 / CCTCC AB 2017280 / YN-1)
A2BJD9 8.93e-30 112 37 2 152 3 Hbut_0228 Peroxiredoxin Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5)
A5IIX7 1.22e-29 112 35 3 178 3 Tpet_0121 Peroxiredoxin Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q9WZR4 3.61e-29 110 35 3 178 3 TM_0807 Peroxiredoxin Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A8A9P0 3.19e-28 108 35 3 174 3 Igni_0459 Peroxiredoxin Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)
Q8R844 1.36e-27 107 32 3 190 3 TTE2186 Peroxiredoxin 2 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A3DKL1 1.39e-27 107 35 2 152 3 Smar_0058 Peroxiredoxin Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1)
P95895 2.18e-27 106 32 5 199 3 SSO2121 Peroxiredoxin Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q8PYP6 5.88e-27 105 31 5 206 3 MM_0814 Peroxiredoxin Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q9HKX0 6.91e-27 105 32 4 194 3 Ta0473 Peroxiredoxin 1 Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q9Y9L0 1.55e-26 104 36 3 163 1 APE_2278 Peroxiredoxin Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Q96XS5 1.83e-26 103 35 3 169 3 STK_24420 Peroxiredoxin 2 Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q9UZV4 9.03e-26 102 32 2 175 3 PYRAB10420 Peroxiredoxin Pyrococcus abyssi (strain GE5 / Orsay)
O29969 9.11e-26 102 36 2 154 3 AF_0270 Peroxiredoxin Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q58146 3.6e-25 100 32 3 176 3 MJ0736 Peroxiredoxin Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q55060 1.1e-24 99 33 1 157 3 None Peroxiredoxin 1 Sulfuracidifex metallicus
Q974S8 3.72e-24 97 34 1 154 3 STK_05840 Peroxiredoxin 1 Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q74NC6 4.44e-24 97 31 3 176 3 NEQ191 Peroxiredoxin Nanoarchaeum equitans (strain Kin4-M)
O58966 4.96e-24 97 32 2 175 1 ahpC Peroxiredoxin Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q8U218 2.23e-23 95 30 2 175 3 PF1033 Peroxiredoxin Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q8RCY5 3e-23 95 36 2 149 3 TTE0270 Peroxiredoxin 1 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
O33665 3.44e-23 95 33 1 154 3 None Peroxiredoxin 2 Sulfuracidifex metallicus
Q6L240 5.57e-23 95 30 3 176 3 PTO0377 Peroxiredoxin 1 Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
Q5JF30 1.94e-22 93 32 2 175 1 TK0537 Peroxiredoxin Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
A6UPH7 6.46e-22 92 31 4 176 3 Mevan_0492 Peroxiredoxin Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Q6LY19 1.04e-21 91 31 5 178 3 MMP1174 Peroxiredoxin Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
A4FWZ9 7.3e-21 89 31 5 178 3 MmarC5_0413 Peroxiredoxin Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
O26262 9.73e-19 83 29 4 180 3 MTH_159 Peroxiredoxin Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q57109 1.03e-18 83 31 3 154 3 MTBMA_c06100 Peroxiredoxin Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q8KBN8 1.25e-18 83 34 3 150 3 CT1747 Peroxiredoxin Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q73RS4 2.43e-18 82 35 3 145 3 TDE_0011 Peroxiredoxin Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
P34227 3.39e-18 83 29 3 185 1 PRX1 Peroxiredoxin PRX1, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P52574 7.93e-18 81 29 2 177 2 None Probable 1-Cys peroxiredoxin Syntrichia ruralis
Q54SE2 2.3e-17 80 27 3 176 3 DDB_G0282517 1-Cys peroxiredoxin Dictyostelium discoideum
A2SZW8 2.97e-17 80 32 5 171 2 PER1 1-Cys peroxiredoxin PER1 Zea mays
O35244 1.53e-16 77 30 4 190 1 Prdx6 Peroxiredoxin-6 Rattus norvegicus
Q9LU86 3.78e-16 76 33 5 156 1 PRXQ Peroxiredoxin Q, chloroplastic Arabidopsis thaliana
P52570 7.25e-16 76 31 3 158 2 TSA 1-Cys peroxiredoxin Onchocerca volvulus
P52572 8.35e-16 75 30 1 147 2 PER1 1-Cys peroxiredoxin PER1 Hordeum vulgare
Q6UBI3 1.02e-15 75 31 3 138 2 PRXQ Peroxiredoxin Q, chloroplastic Suaeda salsa
P0C5C9 1.31e-15 75 30 2 160 2 Os07g0638300 1-Cys peroxiredoxin A Oryza sativa subsp. japonica
Q6E2Z6 1.62e-15 75 29 1 148 2 None 1-Cys peroxiredoxin Medicago truncatula
P0C5C8 1.66e-15 75 30 2 160 2 OsI_27030 1-Cys peroxiredoxin A Oryza sativa subsp. indica
P52571 1.74e-15 74 30 1 147 2 None Probable 1-Cys peroxiredoxin (Fragment) Bromus secalinus
O04005 3.33e-15 74 30 4 178 2 PER1 1-Cys peroxiredoxin PER1 Arabidopsis thaliana
Q9MB35 3.34e-15 73 30 2 132 1 PRXQ Peroxiredoxin Q, chloroplastic (Fragment) Sedum lineare
Q6W8Q2 3.37e-15 74 30 1 147 2 PER1 1-Cys peroxiredoxin PER1 Triticum aestivum
O08709 4e-15 73 29 3 190 1 Prdx6 Peroxiredoxin-6 Mus musculus
O17433 1.24e-14 73 31 4 161 1 None 1-Cys peroxiredoxin Dirofilaria immitis
P0C5D5 1.99e-14 72 27 3 155 2 Os06g0196300 Peroxiredoxin Q, chloroplastic Oryza sativa subsp. japonica
P0C5D4 1.99e-14 72 27 3 155 3 OsI_22010 Putative peroxiredoxin Q, chloroplastic Oryza sativa subsp. indica
O77834 2.09e-14 72 29 4 190 1 PRDX6 Peroxiredoxin-6 Bos taurus
Q75SY5 2.28e-14 72 29 3 156 2 AFP1 Peroxiredoxin Q, chloroplastic Gentiana triflora
Q5ZJF4 2.29e-14 72 30 4 190 2 PRDX6 Peroxiredoxin-6 Gallus gallus
Q6QPJ6 1.06e-13 70 28 3 160 1 PRXQ Peroxiredoxin Q, chloroplastic Populus jackii
Q9TSX9 1.19e-13 70 29 4 190 2 PRDX6 Peroxiredoxin-6 Sus scrofa
Q5S1S6 3.08e-13 68 27 3 155 2 PRX1 Peroxiredoxin Q, chloroplastic Triticum aestivum
Q2PFL9 6.11e-13 68 29 4 190 2 PRDX6 Peroxiredoxin-6 Macaca fascicularis
P30041 1.51e-11 64 28 4 190 1 PRDX6 Peroxiredoxin-6 Homo sapiens
P0C5D0 2.26e-11 63 32 5 164 3 OsI_026085 1-Cys peroxiredoxin B Oryza sativa subsp. indica
Q5R7E0 4.62e-11 63 28 4 190 2 PRDX6 Peroxiredoxin-6 Pongo abelii
P0C5D1 9.35e-11 62 31 5 163 1 Os07g0638400 1-Cys peroxiredoxin B Oryza sativa subsp. japonica
P9WIE3 6.4e-10 58 28 5 140 1 ahpE Alkyl hydroperoxide reductase E Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIE2 6.4e-10 58 28 5 140 3 ahpE Alkyl hydroperoxide reductase E Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P65689 6.4e-10 58 28 5 140 3 ahpE Alkyl hydroperoxide reductase E Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P72314 7.18e-08 50 52 0 40 3 ahpC Alkyl hydroperoxide reductase C (Fragment) Rhodospirillum rubrum
Q83CY8 4.09e-07 50 25 4 141 1 bcp Putative peroxiredoxin bcp Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q796Y8 2.86e-05 45 25 5 140 3 ygaF Peroxiredoxin Bcp Bacillus subtilis (strain 168)
Q81SZ9 3.31e-05 45 26 6 141 1 resA Thiol-disulfide oxidoreductase ResA Bacillus anthracis
A0RBT0 3.31e-05 45 26 6 141 3 resA Thiol-disulfide oxidoreductase ResA Bacillus thuringiensis (strain Al Hakam)
Q81FU5 3.87e-05 45 26 6 141 3 resA Thiol-disulfide oxidoreductase ResA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8P9V9 0.000111 44 32 3 90 1 bcp Peroxiredoxin Bcp Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q6HL81 0.000247 43 23 5 138 3 resA Thiol-disulfide oxidoreductase ResA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q73B22 0.000285 43 23 5 138 3 resA Thiol-disulfide oxidoreductase ResA Bacillus cereus (strain ATCC 10987 / NRS 248)
P9WIE1 0.000487 42 25 6 138 1 bcp Putative peroxiredoxin Rv2521 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIE0 0.000487 42 25 6 138 3 bcp Putative peroxiredoxin MT2597 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0AE55 0.000608 42 23 4 130 3 bcp Putative peroxiredoxin bcp Shigella flexneri
P0AE52 0.000608 42 23 4 130 1 bcp Peroxiredoxin Bcp Escherichia coli (strain K12)
P0AE53 0.000608 42 23 4 130 3 bcp Putative peroxiredoxin bcp Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AE54 0.000608 42 23 4 130 3 bcp Putative peroxiredoxin bcp Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_17810
Feature type CDS
Gene ahpC
Product Alkyl hydroperoxide reductase subunit AhpC (peroxiredoxin)
Location 27328 - 27930 (strand: -1)
Length 603 (nucleotides) / 200 (amino acids)

Contig

Accession ZDB_702
Length 42793 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2264
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00578 AhpC/TSA family
PF10417 C-terminal domain of 1-Cys peroxiredoxin

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0450 Defense mechanisms (V) V Alkyl hydroperoxide reductase subunit AhpC (peroxiredoxin)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03386 peroxiredoxin 2/4 [EC:1.11.1.24] Apoptosis - fly -

Protein Sequence

MVLVTRQAPDFTAAAVMGNGEIVDNFNLKKHLNGRPAVIFFWPMDFTFVCPSELIAFDHRYEEFKKRGVEVIGVSMDSEFVHNAWRNTAIDDGGIGPVQYPMIADIKHDIMRAYGVEFPEAGVALRGSFLVDKNGVVRHQVVNDLPLGRNVDEMLRMVDALQFHEEHGDVCPAQWEKGQEGMNASPKGVADFLKKNSGKL

Flanking regions ( +/- flanking 50bp)

TCTGTCTGTTGTTTATTGCCATACTCTATATAATCTTACAGGAGTAAATTATGGTTCTGGTAACCCGTCAAGCCCCCGATTTTACAGCTGCAGCCGTTATGGGTAACGGTGAAATTGTTGATAACTTCAATCTGAAAAAACACCTGAACGGCCGTCCGGCTGTTATCTTCTTCTGGCCGATGGACTTCACTTTCGTCTGCCCTTCTGAGCTGATCGCATTCGATCACCGCTATGAAGAATTCAAAAAACGCGGTGTGGAAGTGATTGGTGTGTCTATGGACTCTGAGTTTGTTCATAACGCATGGCGTAACACTGCTATCGACGATGGCGGTATCGGTCCGGTTCAGTATCCGATGATTGCGGATATCAAACATGACATCATGCGGGCTTACGGTGTTGAGTTTCCGGAAGCCGGTGTTGCTCTGCGCGGTTCTTTCCTGGTGGACAAAAACGGTGTTGTCCGTCATCAGGTCGTCAACGACCTGCCGCTGGGCCGTAACGTAGACGAAATGCTGCGTATGGTTGACGCACTGCAATTCCACGAAGAGCACGGCGATGTATGCCCTGCACAGTGGGAAAAAGGTCAGGAAGGTATGAATGCATCTCCGAAAGGCGTTGCTGACTTCCTGAAAAAGAACTCCGGTAAACTGTAAGTTCCGGCAGTTAAGAGATACAAAAACCAGCCTGCGGGCTGGTTTTTTTG