Homologs in group_2314

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17515 FBDBKF_17515 100.0 Morganella morganii S1 tsaD tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD
EHELCC_17410 EHELCC_17410 100.0 Morganella morganii S2 tsaD tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD
NLDBIP_17785 NLDBIP_17785 100.0 Morganella morganii S4 tsaD tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD
LHKJJB_17705 LHKJJB_17705 100.0 Morganella morganii S3 tsaD tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD
F4V73_RS16690 F4V73_RS16690 96.2 Morganella psychrotolerans tsaD tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD
PMI_RS11715 PMI_RS11715 89.1 Proteus mirabilis HI4320 tsaD tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD

Distribution of the homologs in the orthogroup group_2314

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2314

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EW57 0.0 622 89 0 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Proteus mirabilis (strain HI4320)
B5XU22 0.0 608 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Klebsiella pneumoniae (strain 342)
A9N5Y7 0.0 608 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T678 0.0 608 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Salmonella newport (strain SL254)
A6TE46 0.0 608 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5BG20 0.0 607 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Salmonella paratyphi A (strain AKU_12601)
C0PYY1 0.0 607 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Salmonella paratyphi C (strain RKS4594)
Q5PKX9 0.0 607 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57JQ1 0.0 607 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Salmonella choleraesuis (strain SC-B67)
Q7N0B6 0.0 605 86 0 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P40731 0.0 605 86 0 335 1 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TI59 0.0 605 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Salmonella heidelberg (strain SL476)
B5REG6 0.0 605 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZ44 0.0 605 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Salmonella enteritidis PT4 (strain P125109)
B5FHU3 0.0 605 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Salmonella dublin (strain CT_02021853)
B5F6A4 0.0 605 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Salmonella agona (strain SL483)
Q8Z3M6 0.0 604 85 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Salmonella typhi
Q3YXH9 0.0 604 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Shigella sonnei (strain Ss046)
Q83Q42 0.0 604 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Shigella flexneri
Q0T0J9 0.0 604 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Shigella flexneri serotype 5b (strain 8401)
Q31WX0 0.0 604 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Shigella boydii serotype 4 (strain Sb227)
B2U1G7 0.0 604 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LQD8 0.0 604 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B6I436 0.0 604 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Escherichia coli (strain SE11)
B1IRQ2 0.0 604 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A4M1 0.0 604 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Escherichia coli O9:H4 (strain HS)
B7LZL4 0.0 604 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Escherichia coli O8 (strain IAI1)
B7NJS7 0.0 604 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YRA4 0.0 604 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
B7LGZ9 0.0 604 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Escherichia coli (strain 55989 / EAEC)
A7ZRU6 0.0 604 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
B4TVU2 0.0 603 85 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Salmonella schwarzengrund (strain CVM19633)
A8APV4 0.0 603 85 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B7UIX2 0.0 603 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7MJU0 0.0 603 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Cronobacter sakazakii (strain ATCC BAA-894)
Q32BQ3 0.0 602 85 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
B7ND53 0.0 602 85 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P05852 0.0 602 85 0 335 1 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Escherichia coli (strain K12)
B1XG69 0.0 602 85 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Escherichia coli (strain K12 / DH10B)
C4ZQY1 0.0 602 85 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Escherichia coli (strain K12 / MC4100 / BW2952)
Q8XBK3 0.0 601 85 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Escherichia coli O157:H7
A1JQW9 0.0 600 86 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q1R6R7 0.0 600 85 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Escherichia coli (strain UTI89 / UPEC)
Q8FDG6 0.0 600 85 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TD42 0.0 600 85 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AFY6 0.0 600 85 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Escherichia coli O1:K1 / APEC
B7N068 0.0 600 85 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Escherichia coli O81 (strain ED1a)
B7MB00 0.0 600 85 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
A9MPV5 0.0 599 85 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B1JM18 0.0 598 85 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q665U5 0.0 598 85 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4THT1 0.0 598 85 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Yersinia pestis (strain Pestoides F)
Q1CME2 0.0 598 85 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R7E3 0.0 598 85 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Yersinia pestis bv. Antiqua (strain Angola)
Q74RQ9 0.0 598 85 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Yersinia pestis
B2K2I3 0.0 598 85 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C366 0.0 598 85 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FE71 0.0 598 85 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4WEJ9 0.0 598 84 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Enterobacter sp. (strain 638)
B1LF56 0.0 598 85 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Escherichia coli (strain SMS-3-5 / SECEC)
B2VGJ0 0.0 597 84 0 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A8GJV1 0.0 593 85 0 334 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Serratia proteamaculans (strain 568)
C5BHG1 0.0 590 83 0 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Edwardsiella ictaluri (strain 93-146)
Q6D9D3 0.0 577 82 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DKG9 0.0 573 82 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q2NWE6 0.0 556 78 0 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Sodalis glossinidius (strain morsitans)
B8F7W7 0.0 541 73 1 343 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Glaesserella parasuis serovar 5 (strain SH0165)
B6EM15 0.0 536 72 0 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Aliivibrio salmonicida (strain LFI1238)
P43764 0.0 535 72 1 342 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B5FB82 0.0 535 72 0 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Aliivibrio fischeri (strain MJ11)
Q9L7A5 0.0 532 72 1 343 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A0KGI3 0.0 531 75 0 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q6LV10 0.0 530 72 0 339 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Photobacterium profundum (strain SS9)
Q5QY46 0.0 530 73 0 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B7VIH2 0.0 530 73 0 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Vibrio atlanticus (strain LGP32)
C4LB59 0.0 530 74 0 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
C3LS11 0.0 528 72 0 339 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Vibrio cholerae serotype O1 (strain M66-2)
A5F9E8 0.0 528 72 0 339 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q7MNZ9 0.0 527 73 0 339 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Vibrio vulnificus (strain YJ016)
Q8DEG4 0.0 527 73 0 339 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Vibrio vulnificus (strain CMCP6)
Q87SL5 0.0 527 72 0 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B0BQ60 0.0 526 71 1 342 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GY07 0.0 526 71 1 342 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N1C4 0.0 526 71 1 342 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A4SRB1 0.0 526 74 0 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Aeromonas salmonicida (strain A449)
A6VQW2 0.0 523 73 2 344 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q1LSM0 0.0 520 72 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Baumannia cicadellinicola subsp. Homalodisca coagulata
B0USH5 0.0 518 71 1 339 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Histophilus somni (strain 2336)
Q65RP0 0.0 514 70 2 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A3QBM3 0.0 513 72 0 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q3IHX1 0.0 509 70 0 334 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Pseudoalteromonas translucida (strain TAC 125)
A1SRR5 0.0 508 70 0 334 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A8FS64 0.0 507 71 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Shewanella sediminis (strain HAW-EB3)
Q8EHD6 0.0 507 70 0 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A9L5I3 0.0 507 70 0 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Shewanella baltica (strain OS195)
A6WKK4 0.0 507 70 0 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Shewanella baltica (strain OS185)
B8EBV5 0.0 507 70 0 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Shewanella baltica (strain OS223)
A1S3S8 0.0 507 71 0 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A3D1Q4 1.06e-180 506 70 0 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Shewanella baltica (strain OS155 / ATCC BAA-1091)
P36175 1.27e-180 505 74 1 319 1 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Mannheimia haemolytica
C4K3R9 4.81e-180 504 71 0 333 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q0HSD5 1.35e-179 503 70 0 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Shewanella sp. (strain MR-7)
Q0HG42 1.35e-179 503 70 0 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Shewanella sp. (strain MR-4)
A0KZT8 1.35e-179 503 70 0 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Shewanella sp. (strain ANA-3)
B8CJF1 2.01e-179 503 70 0 338 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Shewanella piezotolerans (strain WP3 / JCM 13877)
A4Y4F3 6.07e-179 501 70 0 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A8H152 1.04e-178 501 70 0 338 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TIN7 5.48e-178 499 69 0 338 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Shewanella halifaxensis (strain HAW-EB4)
B1KHE2 9.66e-178 498 69 0 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Shewanella woodyi (strain ATCC 51908 / MS32)
Q12KB7 1.47e-177 498 69 0 338 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q47W35 4.88e-175 492 69 3 348 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q1IG31 1.39e-174 490 67 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Pseudomonas entomophila (strain L48)
B4RY33 1.39e-174 490 68 1 338 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q88QU6 3.41e-174 489 67 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KJ82 7.11e-174 489 66 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Pseudomonas putida (strain GB-1)
A5VXI4 4e-172 484 66 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B1JDY5 4.17e-172 484 66 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Pseudomonas putida (strain W619)
Q2S8V7 1.09e-171 483 67 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Hahella chejuensis (strain KCTC 2396)
A4XZK6 6.73e-171 481 68 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Pseudomonas mendocina (strain ymp)
Q9I5V7 1.16e-170 481 67 1 339 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4K4W4 1.76e-170 480 65 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q02TI3 1.97e-170 480 67 1 339 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V4G6 3.88e-170 479 67 1 339 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Pseudomonas aeruginosa (strain LESB58)
A6VU47 5.22e-170 479 66 2 344 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Marinomonas sp. (strain MWYL1)
A6UZ83 7.82e-170 478 67 1 339 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Pseudomonas aeruginosa (strain PA7)
Q88A57 2.75e-169 477 66 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3K5S1 1.38e-168 475 65 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Pseudomonas fluorescens (strain Pf0-1)
Q493X8 1.81e-168 475 64 0 339 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Blochmanniella pennsylvanica (strain BPEN)
C3K338 2e-168 475 65 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Pseudomonas fluorescens (strain SBW25)
Q48NU8 3.34e-168 474 65 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4ZMF4 5.29e-168 474 65 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Pseudomonas syringae pv. syringae (strain B728a)
Q0VMU1 1.39e-167 473 65 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A4VHG9 1.29e-166 470 66 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Stutzerimonas stutzeri (strain A1501)
C5BPQ9 8.2e-166 469 66 2 339 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Teredinibacter turnerae (strain ATCC 39867 / T7901)
B3PKA5 1.85e-165 468 66 1 342 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Cellvibrio japonicus (strain Ueda107)
Q31EM1 5.84e-165 467 65 1 340 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A1TYE0 2.71e-164 465 66 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
C1DIY3 1.3e-163 462 65 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q21MU7 3.96e-162 459 65 2 342 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B2FK06 8.4e-159 451 65 1 339 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Stenotrophomonas maltophilia (strain K279a)
Q83C88 1.24e-158 450 62 0 332 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q3JF13 1.35e-158 450 63 1 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q1QYX8 1.03e-157 448 65 1 340 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B4SHI9 1.63e-157 447 64 1 339 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Stenotrophomonas maltophilia (strain R551-3)
B8GPT9 4.38e-156 443 64 1 331 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q8PFV1 1.69e-155 442 63 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Xanthomonas axonopodis pv. citri (strain 306)
Q9PG67 1.87e-155 442 61 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Xylella fastidiosa (strain 9a5c)
Q87B17 8.18e-155 441 61 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U4B5 8.18e-155 441 61 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Xylella fastidiosa (strain M12)
B2I7X4 8.18e-155 441 61 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Xylella fastidiosa (strain M23)
Q3BNE2 7.06e-154 438 62 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q5GV94 7.16e-154 439 63 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SLA3 7.16e-154 439 63 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NYH1 7.16e-154 439 63 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8P494 7.85e-153 436 62 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RXI2 7.85e-153 436 62 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Xanthomonas campestris pv. campestris (strain B100)
Q4UPU5 7.85e-153 436 62 1 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Xanthomonas campestris pv. campestris (strain 8004)
Q0A5M7 1.7e-152 434 63 1 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q6FCK9 1.24e-150 430 62 2 334 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B0V811 1.93e-149 427 62 2 334 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Acinetobacter baumannii (strain AYE)
B2HUS7 1.93e-149 427 62 2 334 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Acinetobacter baumannii (strain ACICU)
B7I2K6 1.93e-149 427 62 2 334 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Acinetobacter baumannii (strain AB0057)
B7H0A7 1.93e-149 427 62 2 334 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Acinetobacter baumannii (strain AB307-0294)
B0VKC7 2.09e-149 426 62 2 334 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Acinetobacter baumannii (strain SDF)
Q602S1 2.72e-149 426 61 0 334 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A1AXM9 6.4e-148 424 60 2 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Ruthia magnifica subsp. Calyptogena magnifica
A1WZH8 9.98e-146 417 62 0 334 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Halorhodospira halophila (strain DSM 244 / SL1)
Q7VQQ9 3.72e-145 416 56 2 352 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Blochmanniella floridana
A5WCC7 6.5e-145 416 59 3 346 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Psychrobacter sp. (strain PRwf-1)
A5CVM3 3.85e-144 413 59 2 332 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q4FV71 1.64e-142 409 58 4 348 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q7NUE3 2.22e-142 409 58 2 340 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q0K862 8.99e-141 405 60 2 338 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q474C0 1.26e-140 404 60 2 338 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q8KA56 1.43e-140 404 56 2 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B3R5H2 3.45e-140 403 60 2 338 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q5ZT08 1.52e-139 401 56 1 333 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q47IP4 1.85e-139 402 58 2 338 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Dechloromonas aromatica (strain RCB)
A5IEF9 3.24e-139 400 56 2 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Legionella pneumophila (strain Corby)
Q1QE85 4.46e-139 401 57 3 351 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
C1DB12 7.69e-139 400 58 3 344 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Laribacter hongkongensis (strain HLHK9)
Q5X2T1 1.69e-138 399 55 2 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Legionella pneumophila (strain Paris)
Q1GYU4 2.15e-138 399 58 2 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q1LK37 7e-138 397 60 2 338 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q5WU89 9.69e-138 397 56 2 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Legionella pneumophila (strain Lens)
Q8XX97 2.6e-137 396 58 2 342 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A4G2A7 3.21e-137 396 57 3 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Herminiimonas arsenicoxydans
Q0AJ91 8.24e-137 395 57 1 338 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q89B07 2.54e-136 393 53 0 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B2U928 3.71e-135 391 57 2 342 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Ralstonia pickettii (strain 12J)
Q8D283 9.17e-135 389 50 1 339 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Wigglesworthia glossinidia brevipalpis
B2JP66 1.75e-134 389 57 2 339 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A1KAI4 3.53e-134 388 59 2 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Azoarcus sp. (strain BH72)
A9IP11 6.21e-134 388 59 2 342 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q5P261 1.57e-133 386 59 1 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q13RW9 5.53e-133 385 57 2 340 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Paraburkholderia xenovorans (strain LB400)
A1KS96 7e-133 385 55 3 353 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q63JF6 6.08e-132 382 56 2 344 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Burkholderia pseudomallei (strain K96243)
Q62DT7 8.25e-132 382 56 2 344 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Burkholderia mallei (strain ATCC 23344)
Q2Y7B6 1.34e-131 382 56 3 338 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q3JKA5 2.3e-131 381 56 2 344 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Burkholderia pseudomallei (strain 1710b)
A3P7W1 2.3e-131 381 56 2 344 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Burkholderia pseudomallei (strain 1106a)
Q82XN2 3.67e-131 380 56 1 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B1Z1G4 4.79e-131 380 56 3 345 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Burkholderia ambifaria (strain MC40-6)
Q1BLY9 5.05e-131 380 56 2 344 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Burkholderia orbicola (strain AU 1054)
B1K3S7 5.05e-131 380 56 2 344 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Burkholderia orbicola (strain MC0-3)
A0AYZ2 5.05e-131 380 56 2 344 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Burkholderia cenocepacia (strain HI2424)
Q0BAL6 8e-131 380 55 2 344 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
A4JLT6 1.02e-130 379 56 3 345 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Burkholderia vietnamiensis (strain G4 / LMG 22486)
A9ANA0 1.41e-130 379 56 2 344 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Burkholderia multivorans (strain ATCC 17616 / 249)
Q393P6 1.43e-130 379 55 2 344 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B4EN31 1.51e-130 379 56 2 344 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A1IQ95 1.7e-130 379 55 3 353 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q30BK9 2.36e-130 379 55 3 353 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Neisseria meningitidis
Q2T7N3 2.38e-130 379 56 2 344 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2L002 2.18e-129 376 57 2 342 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Bordetella avium (strain 197N)
Q7VXN4 5.53e-129 375 58 2 343 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WI34 6.16e-129 375 58 2 343 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q9JY06 1.06e-128 375 54 3 353 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
B8D6X0 3.53e-128 373 54 2 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57166 3.53e-128 373 54 2 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8L6 3.53e-128 373 54 2 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q5NIC9 3.97e-128 372 55 5 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
B2SFD9 3.97e-128 372 55 5 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Francisella tularensis subsp. mediasiatica (strain FSC147)
Q14JT2 3.97e-128 372 55 5 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Francisella tularensis subsp. tularensis (strain FSC 198)
Q7W668 4.03e-128 373 57 2 343 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
A4SZK1 5.37e-128 373 54 4 351 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A4IWA2 8.92e-128 372 55 5 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Francisella tularensis subsp. tularensis (strain WY96-3418)
A0Q864 1.16e-127 371 55 5 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Francisella tularensis subsp. novicida (strain U112)
B4RQ33 1.23e-126 369 53 3 353 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Neisseria gonorrhoeae (strain NCCP11945)
Q5FAC2 1.23e-126 369 53 3 353 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q0BKC8 1.92e-126 368 55 5 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Francisella tularensis subsp. holarctica (strain OSU18)
Q2A1N0 1.92e-126 368 55 5 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Francisella tularensis subsp. holarctica (strain LVS)
A7NEB6 1.63e-125 366 54 5 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
B1XVZ2 4.45e-125 365 52 3 351 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Polynucleobacter necessarius subsp. necessarius (strain STIR1)
B0TX13 4.9e-124 362 54 5 333 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A5EWZ5 3.97e-123 360 51 0 334 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Dichelobacter nodosus (strain VCS1703A)
Q3SGB3 1.18e-121 356 55 3 343 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Thiobacillus denitrificans (strain ATCC 25259)
A1VM52 5.65e-118 347 53 3 345 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Polaromonas naphthalenivorans (strain CJ2)
Q21WR0 8.64e-118 347 55 4 350 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
C5CT30 3.78e-115 340 53 3 342 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Variovorax paradoxus (strain S110)
A1W9P4 5.05e-114 337 53 3 338 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Acidovorax sp. (strain JS42)
A1TP41 1.15e-113 336 54 3 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Paracidovorax citrulli (strain AAC00-1)
A1WHJ5 1.24e-113 336 53 3 338 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Verminephrobacter eiseniae (strain EF01-2)
A2SFL8 1.27e-112 333 53 3 343 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q3A3G6 4.99e-109 324 49 3 334 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q058D1 2.44e-107 320 44 2 325 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Buchnera aphidicola subsp. Cinara cedri (strain Cc)
O66986 9.7e-107 318 47 3 334 1 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Aquifex aeolicus (strain VF5)
Q127W3 2.21e-105 315 53 4 339 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Polaromonas sp. (strain JS666 / ATCC BAA-500)
A0L5L8 1.23e-104 313 50 4 346 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q2LSP8 6.03e-102 306 47 2 333 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Syntrophus aciditrophicus (strain SB)
A5G3X1 1.7e-100 302 47 2 333 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Geotalea uraniireducens (strain Rf4)
B9M2S8 3.27e-100 301 46 2 333 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q2VYV2 9.26e-100 301 48 6 342 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
A1ARX8 1.15e-99 300 48 2 333 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B5YDS4 1.26e-99 300 45 3 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
A7HGZ6 1.52e-99 300 47 2 333 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Anaeromyxobacter sp. (strain Fw109-5)
C0QTG9 3.89e-99 299 44 5 328 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Persephonella marina (strain DSM 14350 / EX-H1)
B8EJI6 1.48e-98 298 47 6 343 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q8FYI5 8.54e-98 296 51 8 346 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Brucella suis biovar 1 (strain 1330)
Q8YJB1 8.54e-98 296 51 8 346 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RFD2 8.54e-98 296 51 8 346 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Brucella melitensis biotype 2 (strain ATCC 23457)
A9M8M3 8.73e-98 296 51 8 346 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57B07 3.08e-97 295 51 8 346 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Brucella abortus biovar 1 (strain 9-941)
Q2YLM4 3.08e-97 295 51 8 346 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Brucella abortus (strain 2308)
B2S843 3.08e-97 295 51 8 346 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Brucella abortus (strain S19)
B0CIE0 3.54e-97 295 51 8 346 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VSL6 3.62e-97 295 51 8 346 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q0C5X3 1.65e-96 293 47 8 343 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Hyphomonas neptunium (strain ATCC 15444)
B3E4U4 3.4e-96 291 47 3 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q1GP42 3.44e-96 291 47 4 331 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q39W35 6.9e-96 291 47 3 334 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q67K94 7.61e-96 290 47 2 326 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q24QC9 1.27e-95 290 47 1 315 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Desulfitobacterium hafniense (strain Y51)
C6E7C1 3.41e-95 289 47 2 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Geobacter sp. (strain M21)
Q81IS8 3.67e-95 289 44 4 328 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B8E1B4 4.74e-95 288 44 3 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
Q4FNV6 4.97e-95 289 43 6 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Pelagibacter ubique (strain HTCC1062)
B5YKX4 5.29e-95 288 45 5 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
A0R8V9 1.3e-94 288 44 4 328 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Bacillus thuringiensis (strain Al Hakam)
Q73ES6 1.35e-94 287 44 4 328 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Bacillus cereus (strain ATCC 10987 / NRS 248)
Q6HPD3 1.49e-94 287 44 4 328 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Bacillus thuringiensis subsp. konkukian (strain 97-27)
O05518 1.77e-94 287 43 4 342 1 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Bacillus subtilis (strain 168)
Q2VNJ2 3.03e-94 287 46 5 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Methylocapsa acidiphila
Q2IFU7 3.18e-94 286 46 2 332 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Anaeromyxobacter dehalogenans (strain 2CP-C)
A9IZF6 3.3e-94 287 48 8 353 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q63GW2 6.54e-94 286 44 4 328 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Bacillus cereus (strain ZK / E33L)
Q6I4E9 6.54e-94 286 44 4 328 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Bacillus anthracis
B8J7H2 6.58e-94 285 46 2 332 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q5NL82 1.04e-93 286 43 2 334 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
B9KXJ0 1.38e-93 286 44 4 358 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
A6UDR4 1.74e-93 285 49 11 352 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Sinorhizobium medicae (strain WSM419)
A3DJ13 2.03e-93 284 43 1 333 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
A4IJU4 2.21e-93 284 45 4 332 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Geobacillus thermodenitrificans (strain NG80-2)
Q6G1R3 2.86e-93 285 48 8 353 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q2YUG0 3.45e-93 284 41 3 333 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Staphylococcus aureus (strain bovine RF122 / ET3-1)
A8Z4V2 5.81e-93 283 41 3 333 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Staphylococcus aureus (strain USA300 / TCH1516)
A6QIP6 5.81e-93 283 41 3 333 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Staphylococcus aureus (strain Newman)
Q5HEF2 5.81e-93 283 41 3 333 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Staphylococcus aureus (strain COL)
Q2FWL2 5.81e-93 283 41 3 333 1 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FF75 5.81e-93 283 41 3 333 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Staphylococcus aureus (strain USA300)
Q92LH8 5.88e-93 284 49 9 347 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Rhizobium meliloti (strain 1021)
Q6GF23 8.5e-93 283 41 3 333 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Staphylococcus aureus (strain MRSA252)
C1A601 8.82e-93 283 49 5 334 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
Q74C11 1.43e-92 282 46 2 332 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A6WXJ1 1.47e-92 283 50 7 348 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q8NVJ5 1.92e-92 282 41 3 333 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Staphylococcus aureus (strain MW2)
Q6G7Q8 1.92e-92 282 41 3 333 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Staphylococcus aureus (strain MSSA476)
B1LA07 2.72e-92 281 44 2 328 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Thermotoga sp. (strain RQ2)
A5IKS6 2.72e-92 281 44 2 328 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
A5IUJ5 3.2e-92 281 40 3 333 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Staphylococcus aureus (strain JH9)
A6U3D4 3.2e-92 281 40 3 333 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Staphylococcus aureus (strain JH1)
A0M1X3 3.53e-92 281 41 5 339 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q2RND2 4.05e-92 282 46 7 345 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q7A4H8 4.43e-92 281 40 3 333 1 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Staphylococcus aureus (strain N315)
Q99SK3 4.43e-92 281 40 3 333 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A7X4L9 4.43e-92 281 40 3 333 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q7V660 9.31e-92 281 47 4 340 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Prochlorococcus marinus (strain MIT 9313)
Q88YN0 9.6e-92 280 44 5 342 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q65N07 1.08e-91 280 42 5 338 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A5N5B9 1.22e-91 280 42 2 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DYW7 1.22e-91 280 42 2 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Clostridium kluyveri (strain NBRC 12016)
B9K6Y6 1.23e-91 279 44 2 327 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
Q929U3 1.4e-91 280 44 5 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A4XM18 1.79e-91 279 43 3 333 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q9WXZ2 2.03e-91 279 44 2 328 1 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B2V910 6.22e-91 278 43 8 340 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Sulfurihydrogenibium sp. (strain YO3AOP1)
A2C0S7 1.12e-90 278 45 4 340 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Prochlorococcus marinus (strain NATL1A)
Q49Z04 1.43e-90 277 42 4 325 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8Y5I7 1.73e-90 277 44 4 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q3YS67 1.87e-90 277 42 5 339 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Ehrlichia canis (strain Jake)
Q8ESI6 2.07e-90 276 46 6 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q71XT8 2.42e-90 276 43 4 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Listeria monocytogenes serotype 4b (strain F2365)
C1KX28 2.42e-90 276 43 4 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Listeria monocytogenes serotype 4b (strain CLIP80459)
A6LQD5 2.44e-90 276 41 1 333 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q11TP2 2.7e-90 276 45 4 316 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q97KL6 2.77e-90 276 42 1 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B9MKR8 2.88e-90 276 44 3 322 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q6FYF1 2.9e-90 277 46 8 356 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Bartonella quintana (strain Toulouse)
Q2GGH9 2.96e-90 276 43 5 339 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
A2C7G2 3.06e-90 277 46 4 340 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Prochlorococcus marinus (strain MIT 9303)
Q8CNL9 3.3e-90 276 41 4 325 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HMG7 3.3e-90 276 41 4 325 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B9DML1 4.86e-90 276 42 4 322 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Staphylococcus carnosus (strain TM300)
Q5L3F6 9.85e-90 275 43 4 332 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Geobacillus kaustophilus (strain HTA426)
Q3AE55 1.17e-89 275 43 3 331 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q4L7T2 1.5e-89 275 41 3 321 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Staphylococcus haemolyticus (strain JCSC1435)
B7IGB4 1.56e-89 274 41 1 331 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Thermosipho africanus (strain TCF52B)
Q64TJ9 2.43e-89 274 44 5 322 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Bacteroides fragilis (strain YCH46)
Q5LCF3 2.43e-89 274 44 5 322 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q03E69 2.44e-89 274 43 6 334 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
A4VSP7 2.49e-89 274 46 4 314 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus suis (strain 05ZYH33)
A4VYZ0 2.49e-89 274 46 4 314 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus suis (strain 98HAH33)
Q46GV3 3.71e-89 274 45 6 344 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Prochlorococcus marinus (strain NATL2A)
Q8RFX8 5.42e-89 273 42 4 319 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q2GK88 5.47e-89 273 42 5 339 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Anaplasma phagocytophilum (strain HZ)
C5CD32 6.05e-89 273 43 3 334 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
B1IFE9 8.19e-89 273 41 1 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Clostridium botulinum (strain Okra / Type B1)
Q8A997 8.2e-89 273 44 5 321 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
A7GIP8 9.54e-89 272 41 1 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
A5I738 9.54e-89 272 41 1 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FYQ8 9.54e-89 272 41 1 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Clostridium botulinum (strain ATCC 19397 / Type A)
Q8XI89 1.04e-88 272 41 1 333 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Clostridium perfringens (strain 13 / Type A)
Q0TN80 1.04e-88 272 41 1 333 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q38YS5 1.67e-88 272 43 4 329 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Latilactobacillus sakei subsp. sakei (strain 23K)
Q2G4K2 1.78e-88 272 45 3 338 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q0SQV5 1.85e-88 271 40 1 333 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Clostridium perfringens (strain SM101 / Type A)
Q0AVU0 2.13e-88 271 45 1 305 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q9KFD3 2.52e-88 271 42 6 340 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
C3KUS7 2.53e-88 271 41 1 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Clostridium botulinum (strain 657 / Type Ba4)
A5CE49 3.2e-88 271 41 5 346 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Orientia tsutsugamushi (strain Boryong)
Q2N8R7 3.2e-88 271 44 4 331 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Erythrobacter litoralis (strain HTCC2594)
A0Q2U7 3.66e-88 271 40 2 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Clostridium novyi (strain NT)
A9FDL0 3.74e-88 271 45 4 345 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Sorangium cellulosum (strain So ce56)
A8AUT2 4.28e-88 271 43 5 328 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
A8LP83 4.85e-88 271 45 7 347 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
B3CRT6 4.99e-88 271 41 5 346 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Orientia tsutsugamushi (strain Ikeda)
Q6AL73 6.06e-88 270 44 4 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q8DRH2 6.76e-88 270 43 5 328 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04MU2 6.76e-88 270 43 5 328 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q03SR5 8.45e-88 270 44 4 328 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
B1L1Z3 8.63e-88 270 41 1 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Clostridium botulinum (strain Loch Maree / Type A3)
C1FLX0 9.21e-88 270 41 1 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Clostridium botulinum (strain Kyoto / Type A2)
Q8DLI9 1.17e-87 270 45 3 344 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
B1GZV6 2.16e-87 269 42 4 338 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Endomicrobium trichonymphae
A0AKI2 2.18e-87 269 42 5 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
B2G5W6 2.38e-87 269 43 5 329 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VID8 2.38e-87 269 43 5 329 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Limosilactobacillus reuteri (strain DSM 20016)
B7GFQ4 2.39e-87 269 42 4 334 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
A3CKS0 2.68e-87 268 42 5 328 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus sanguinis (strain SK36)
Q5FPS6 3.04e-87 270 44 7 346 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Gluconobacter oxydans (strain 621H)
Q1GCQ5 3.32e-87 269 43 6 351 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Ruegeria sp. (strain TM1040)
A5GMV4 3.37e-87 269 46 5 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Synechococcus sp. (strain WH7803)
Q5FGU3 3.98e-87 268 40 5 339 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Ehrlichia ruminantium (strain Gardel)
C0MER2 5.18e-87 268 45 5 328 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus equi subsp. zooepidemicus (strain H70)
C0M9J5 5.18e-87 268 45 5 328 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus equi subsp. equi (strain 4047)
Q8RC98 5.69e-87 268 41 2 333 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q7U573 6.56e-87 268 45 5 345 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Parasynechococcus marenigrum (strain WH8102)
C1CAF6 7.04e-87 268 44 5 315 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus pneumoniae (strain 70585)
B2IRL3 7.19e-87 268 43 5 328 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus pneumoniae (strain CGSP14)
Q73H71 7.36e-87 267 39 5 334 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Wolbachia pipientis wMel
Q5HBC3 8.14e-87 268 40 5 339 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Ehrlichia ruminantium (strain Welgevonden)
C0R3B8 8.56e-87 267 39 5 334 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Wolbachia sp. subsp. Drosophila simulans (strain wRi)
C1CBV0 8.83e-87 267 44 5 315 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus pneumoniae (strain JJA)
Q891E7 9.69e-87 267 40 2 334 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Clostridium tetani (strain Massachusetts / E88)
A7HLB0 9.73e-87 267 40 4 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
B8ZK13 1.05e-86 267 44 5 315 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
Q97T27 1.29e-86 267 44 5 315 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B4U0X7 1.34e-86 267 45 5 328 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
Q18CP0 1.42e-86 267 39 1 332 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Clostridioides difficile (strain 630)
B0JJJ4 1.47e-86 267 42 2 342 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
C1CI40 1.59e-86 266 44 5 315 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus pneumoniae (strain P1031)
A9NHW6 1.7e-86 266 43 4 316 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Acholeplasma laidlawii (strain PG-8A)
Q2RGJ3 1.72e-86 267 43 1 331 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
C1CP14 1.83e-86 266 44 5 315 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus pneumoniae (strain Taiwan19F-14)
B2GAG0 1.93e-86 266 41 4 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
B1I843 3.18e-86 266 44 5 315 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus pneumoniae (strain Hungary19A-6)
Q0I865 3.18e-86 266 46 5 342 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Synechococcus sp. (strain CC9311)
B5E614 3.28e-86 266 44 5 315 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus pneumoniae serotype 19F (strain G54)
Q1RH23 3.83e-86 266 39 5 340 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Rickettsia bellii (strain RML369-C)
A8GU95 3.83e-86 266 39 5 340 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Rickettsia bellii (strain OSU 85-389)
A6LKP0 5.98e-86 265 41 4 331 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
A8F0E3 6.93e-86 265 39 6 343 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Rickettsia massiliae (strain Mtu5)
Q1WSV5 7.09e-86 265 43 4 328 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Ligilactobacillus salivarius (strain UCC118)
Q5PAV6 9.95e-86 265 41 4 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Anaplasma marginale (strain St. Maries)
Q8NZG7 1.12e-85 265 42 5 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XA26 1.12e-85 265 42 5 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
B3R0M3 1.17e-85 264 39 3 318 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Phytoplasma mali (strain AT)
Q2GEG6 1.18e-85 264 42 5 327 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
Q48RG7 1.21e-85 265 42 5 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1J4Y7 1.21e-85 265 42 5 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q8DVT0 1.4e-85 264 44 6 328 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q7NKX2 1.5e-85 264 45 4 331 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q035Y0 1.52e-85 264 44 6 324 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3W9X7 1.52e-85 264 44 6 324 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Lacticaseibacillus casei (strain BL23)
Q2K3D7 1.97e-85 265 48 9 349 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q03IT6 2.31e-85 264 43 4 332 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
A8GQJ1 2.38e-85 264 39 6 343 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Rickettsia rickettsii (strain Sheila Smith)
B0BVX7 2.38e-85 264 39 6 343 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Rickettsia rickettsii (strain Iowa)
B5XIE3 2.44e-85 264 42 5 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus pyogenes serotype M49 (strain NZ131)
P0DD29 2.44e-85 264 42 5 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus pyogenes serotype M3 (strain SSI-1)
A2RCM9 2.44e-85 264 42 5 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1JK40 2.44e-85 264 42 5 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1J9Z2 2.44e-85 264 42 5 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus pyogenes serotype M12 (strain MGAS2096)
P0DD28 2.44e-85 264 42 5 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q99Y46 2.44e-85 264 42 5 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus pyogenes serotype M1
Q5M2N7 2.52e-85 263 43 4 332 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LY32 2.52e-85 263 43 4 332 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus thermophilus (strain CNRZ 1066)
Q3AWM4 2.54e-85 264 45 4 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Synechococcus sp. (strain CC9902)
C0Q8X7 3.01e-85 263 44 1 329 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
Q98EI6 4.09e-85 264 48 9 351 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A1UQZ7 4.85e-85 264 46 4 350 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
B4SBN2 4.88e-85 263 41 4 346 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
C4K157 6.46e-85 263 39 6 343 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Rickettsia peacockii (strain Rustic)
A6L5E2 8.73e-85 262 42 5 321 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q1JF32 9.17e-85 262 41 5 336 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus pyogenes serotype M2 (strain MGAS10270)
B9DVQ7 9.97e-85 262 45 4 314 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q1MAQ8 1.05e-84 263 49 9 347 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q0ATQ2 1.4e-84 263 43 5 345 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Maricaulis maris (strain MCS10)
Q92JK6 1.57e-84 262 38 5 342 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q5GT66 1.63e-84 261 38 5 334 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Wolbachia sp. subsp. Brugia malayi (strain TRS)
Q5LLR7 1.95e-84 262 43 5 350 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q7MU42 2.33e-84 261 41 5 324 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B3CLX6 3.87e-84 260 39 4 334 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Wolbachia pipientis subsp. Culex pipiens (strain wPip)
C3PM69 4.17e-84 261 39 6 343 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Rickettsia africae (strain ESF-5)
Q032D4 4.52e-84 260 43 5 323 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Lactococcus lactis subsp. cremoris (strain SK11)
A2RI22 6.39e-84 260 43 5 323 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Lactococcus lactis subsp. cremoris (strain MG1363)
B4S5Q4 6.85e-84 260 41 5 341 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q8E3F9 8.18e-84 259 43 4 327 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus agalactiae serotype III (strain NEM316)
Q9CIR1 8.3e-84 260 43 6 323 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Lactococcus lactis subsp. lactis (strain IL1403)
B8J025 8.6e-84 260 44 5 343 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q9F0V0 9.24e-84 259 38 6 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Riemerella anatipestifer
Q11DF0 9.56e-84 260 47 5 346 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Chelativorans sp. (strain BNC1)
Q73JV7 1.3e-83 259 43 4 332 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q3ALX3 1.73e-83 259 45 5 342 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Synechococcus sp. (strain CC9605)
B3EPA8 2.42e-83 259 43 5 330 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Chlorobium phaeobacteroides (strain BS1)
A3PG14 2.44e-83 259 45 6 347 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A4SCN7 2.46e-83 259 43 7 342 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q0RM11 3.22e-83 259 46 3 318 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q7VDB5 3.96e-83 258 42 4 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
B3PQA4 4.05e-83 259 48 9 349 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Rhizobium etli (strain CIAT 652)
B5ZTC5 4.66e-83 259 48 9 347 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q831N0 4.89e-83 258 42 7 335 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Enterococcus faecalis (strain ATCC 700802 / V583)
Q3JZC7 5.57e-83 258 42 4 334 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q8DXT9 7.87e-83 257 41 4 334 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
B2TJK1 1.08e-82 257 38 3 337 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Clostridium botulinum (strain Eklund 17B / Type B)
Q8UC47 1.26e-82 258 47 8 348 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Agrobacterium fabrum (strain C58 / ATCC 33970)
B7K765 1.53e-82 257 41 3 339 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Gloeothece citriformis (strain PCC 7424)
B1X058 1.74e-82 256 42 3 340 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Crocosphaera subtropica (strain ATCC 51142 / BH68)
Q3Z6L5 2.42e-82 256 44 6 334 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q6A6V2 2.6e-82 256 44 4 323 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q3J6D2 2.78e-82 257 45 6 347 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q82DK2 2.8e-82 257 46 4 312 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A1VD24 2.99e-82 256 43 4 347 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Nitratidesulfovibrio vulgaris (strain DP4)
Q72B00 2.99e-82 256 43 4 347 1 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q72J91 3.36e-82 255 45 6 334 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
A1B3J6 3.56e-82 256 45 5 340 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Paracoccus denitrificans (strain Pd 1222)
Q6AD38 3.72e-82 256 45 6 346 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Leifsonia xyli subsp. xyli (strain CTCB07)
A4WWN6 4.79e-82 256 45 7 349 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q9ABZ9 5.58e-82 256 44 7 346 3 tsaD tRNA N6-adenosine threonylcarbamoyltransferase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_17715
Feature type CDS
Gene tsaD
Product tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD
Location 5074 - 6093 (strand: 1)
Length 1020 (nucleotides) / 339 (amino acids)
In genomic island -

Contig

Accession ZDB_702
Length 42793 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2314
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00814 tRNA N6-adenosine threonylcarbamoyltransferase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0533 Translation, ribosomal structure and biogenesis (J) J tRNA A37 threonylcarbamoyltransferase TsaD

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K25706 tRNA N6-adenosine threonylcarbamoyltransferase [EC:2.3.1.234] - -

Protein Sequence

MRVLGIETSCDETGIAIYDDEAGLLANQLYSQIKVHADYGGVVPELASRDHIRKTVPLIQAALKEAGLTAQDIDAVAYTAGPGLVGALMVGATVGRALAFSWNVPAVPVHHMEGHLLAPMLEEHQPEFPFVALLVSGGHTQLISVTGIGEYTLLGESIDDAAGEAFDKTAKLLGLDYPGGPALSRMAAQGTPGRFTFPRPMTDRPGLDFSFSGLKTFAANTIHQNDDSDQTKADIARAFEDAVVDTLVIKCKRALEQTGFKRLVMAGGVSANRTLRERMAQTLQKLGGEAFYARPELCTDNGAMIALAGMIRFKGGMRSELGVTVRPRWPLAELPPLDK

Flanking regions ( +/- flanking 50bp)

TGCTGTCCGCCGCCAGTCCCGTCAGTTTTTGTTCCAGCGAGTTAAGTCCCATGCGAGTGTTAGGCATTGAAACGTCCTGCGATGAAACCGGAATCGCAATTTATGATGATGAAGCCGGTTTGCTGGCTAATCAGTTATACAGTCAGATCAAAGTCCACGCGGATTACGGCGGTGTGGTGCCGGAACTGGCATCCCGTGACCATATCCGGAAAACGGTGCCGCTGATTCAGGCAGCACTGAAAGAAGCCGGTCTGACGGCACAGGATATTGATGCGGTGGCCTATACCGCAGGACCGGGGTTGGTCGGGGCGCTGATGGTCGGGGCGACAGTCGGCCGTGCGCTGGCGTTTTCCTGGAATGTCCCGGCGGTGCCGGTTCACCATATGGAAGGCCATCTGCTGGCACCGATGCTGGAAGAACATCAGCCGGAGTTTCCGTTTGTCGCGCTGCTGGTATCCGGCGGTCATACGCAGTTAATCAGTGTAACCGGTATCGGTGAATACACGCTGCTGGGTGAATCTATCGATGATGCAGCCGGGGAAGCCTTTGATAAAACAGCCAAATTACTGGGTCTGGATTATCCGGGCGGGCCTGCACTGTCACGCATGGCAGCACAGGGCACGCCGGGACGTTTTACCTTCCCGCGTCCGATGACCGACCGGCCGGGGCTGGATTTCAGCTTCTCCGGGCTGAAAACCTTTGCCGCTAATACCATTCATCAGAATGATGATTCAGACCAGACAAAGGCGGATATCGCCCGTGCTTTTGAAGATGCGGTGGTCGATACGCTGGTGATCAAATGCAAACGCGCGCTGGAGCAGACCGGATTTAAACGGCTGGTGATGGCAGGCGGCGTGAGTGCAAACCGCACGCTGCGCGAACGCATGGCGCAGACACTGCAAAAACTGGGCGGAGAAGCGTTCTATGCCCGTCCTGAACTGTGTACGGATAACGGTGCGATGATCGCGCTGGCCGGGATGATCCGCTTCAAAGGCGGTATGCGCAGTGAATTAGGCGTGACTGTCCGTCCGCGGTGGCCGCTGGCTGAGTTACCGCCGCTGGACAAATAATTTCCGGACACAAAAAAGGCGCCTCAGCGCCTTTTTTTAATCTTCTTTTT