Homologs in group_2128

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15990 FBDBKF_15990 100.0 Morganella morganii S1 rsmS pleiotropic regulatory protein RsmS
EHELCC_18595 EHELCC_18595 100.0 Morganella morganii S2 rsmS pleiotropic regulatory protein RsmS
NLDBIP_17425 NLDBIP_17425 100.0 Morganella morganii S4 rsmS pleiotropic regulatory protein RsmS
LHKJJB_17235 LHKJJB_17235 100.0 Morganella morganii S3 rsmS pleiotropic regulatory protein RsmS
F4V73_RS16320 F4V73_RS16320 74.1 Morganella psychrotolerans rsmS pleiotropic regulatory protein RsmS
PMI_RS18805 PMI_RS18805 52.9 Proteus mirabilis HI4320 rsmS pleiotropic regulatory protein RsmS

Distribution of the homologs in the orthogroup group_2128

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2128

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P45807 1.45e-19 75 75 1 53 4 ybaM Uncharacterized protein YbaM Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_17160
Feature type CDS
Gene rsmS
Product pleiotropic regulatory protein RsmS
Location 39980 - 40144 (strand: -1)
Length 165 (nucleotides) / 54 (amino acids)

Contig

Accession ZDB_699
Length 56187 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2128
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF10689 Protein of unknown function (DUF2496)

Protein Sequence

MSLENAPDEVKLAVDLICLLEENRIPAATVLAALQIVRRDYENKLRDTENDQAG

Flanking regions ( +/- flanking 50bp)

AGATTGAACGCCACGACGGCACCGAATTTTAATCAGATACCGGATACCCCATGAGTCTTGAAAATGCCCCCGATGAGGTAAAACTGGCGGTCGATCTTATCTGTCTGCTGGAAGAGAACCGCATCCCGGCCGCAACCGTGCTCGCGGCGTTACAGATTGTCCGCCGCGATTATGAAAACAAACTGCGCGATACAGAGAACGATCAGGCCGGCTGAGCGCCGTCATCCTTTCCCTGCACCTGCACTTCTTTGCCGCTGTTCTGATC