Homologs in group_2165

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15990 FBDBKF_15990 74.1 Morganella morganii S1 rsmS pleiotropic regulatory protein RsmS
EHELCC_18595 EHELCC_18595 74.1 Morganella morganii S2 rsmS pleiotropic regulatory protein RsmS
NLDBIP_17425 NLDBIP_17425 74.1 Morganella morganii S4 rsmS pleiotropic regulatory protein RsmS
LHKJJB_17235 LHKJJB_17235 74.1 Morganella morganii S3 rsmS pleiotropic regulatory protein RsmS
HKOGLL_17160 HKOGLL_17160 74.1 Morganella morganii S5 rsmS pleiotropic regulatory protein RsmS
PMI_RS18805 PMI_RS18805 54.9 Proteus mirabilis HI4320 rsmS pleiotropic regulatory protein RsmS

Distribution of the homologs in the orthogroup group_2165

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2165

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P45807 1.45e-16 68 75 0 44 4 ybaM Uncharacterized protein YbaM Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS16320
Feature type CDS
Gene rsmS
Product pleiotropic regulatory protein RsmS
Location 77589 - 77753 (strand: 1)
Length 165 (nucleotides) / 54 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000006
Length 212134 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2165
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF10689 Protein of unknown function (DUF2496)

Protein Sequence

MSLDNAPDEVKLAVDLICLLESHQIPAETVLAALEIVRQDYETKQRNAPGGQAG

Flanking regions ( +/- flanking 50bp)

CTGCAGTTTGGATGAATACGGGGATATACTCTAAATAATACAGAGAACCTATGAGTCTGGACAACGCACCCGATGAGGTAAAACTGGCTGTTGACCTCATCTGTTTACTGGAAAGCCACCAGATACCGGCAGAGACGGTTCTGGCGGCATTAGAGATTGTCCGGCAGGATTATGAAACAAAACAGCGCAATGCGCCCGGTGGTCAGGCAGGCTGAACCCCGTTATCTGGTCCCTGTACCTGCACTTCTTTTCCGCTGTTCTGATC