Homologs in group_40

Help

13 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01175 FBDBKF_01175 67.0 Morganella morganii S1 glnB nitrogen regulatory protein P-II
FBDBKF_15935 FBDBKF_15935 100.0 Morganella morganii S1 glnK Nitrogen regulatory protein PII
EHELCC_00370 EHELCC_00370 67.0 Morganella morganii S2 glnB nitrogen regulatory protein P-II
EHELCC_18535 EHELCC_18535 100.0 Morganella morganii S2 glnK Nitrogen regulatory protein PII
NLDBIP_03090 NLDBIP_03090 67.0 Morganella morganii S4 glnB nitrogen regulatory protein P-II
NLDBIP_17370 NLDBIP_17370 100.0 Morganella morganii S4 glnK Nitrogen regulatory protein PII
LHKJJB_04605 LHKJJB_04605 67.0 Morganella morganii S3 glnB nitrogen regulatory protein P-II
LHKJJB_17290 LHKJJB_17290 100.0 Morganella morganii S3 glnK Nitrogen regulatory protein PII
HKOGLL_02440 HKOGLL_02440 67.0 Morganella morganii S5 glnB nitrogen regulatory protein P-II
F4V73_RS07245 F4V73_RS07245 67.9 Morganella psychrotolerans glnB nitrogen regulatory protein P-II
F4V73_RS16375 F4V73_RS16375 80.4 Morganella psychrotolerans - P-II family nitrogen regulator
PMI_RS00610 PMI_RS00610 57.1 Proteus mirabilis HI4320 - P-II family nitrogen regulator
PMI_RS09230 PMI_RS09230 63.4 Proteus mirabilis HI4320 glnB nitrogen regulatory protein P-II

Distribution of the homologs in the orthogroup group_40

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_40

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A9Z6 1.77e-48 153 66 0 112 3 glnB Nitrogen regulatory protein P-II 1 Shigella flexneri
P0A9Z4 1.77e-48 153 66 0 112 3 glnB Nitrogen regulatory protein P-II 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A9Z5 1.77e-48 153 66 0 112 3 glnB Nitrogen regulatory protein P-II 1 Salmonella typhi
P0A9Z1 1.77e-48 153 66 0 112 1 glnB Nitrogen regulatory protein P-II 1 Escherichia coli (strain K12)
P0A9Z2 1.77e-48 153 66 0 112 3 glnB Nitrogen regulatory protein P-II 1 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9Z3 1.77e-48 153 66 0 112 3 glnB Nitrogen regulatory protein P-II 1 Escherichia coli O157:H7
P43795 3.81e-48 152 64 0 112 3 glnB Nitrogen regulatory protein P-II Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CJK1 4.34e-48 152 65 0 112 3 glnB Nitrogen regulatory protein P-II Pasteurella multocida (strain Pm70)
O54053 2.51e-47 150 64 0 112 3 glnB Nitrogen regulatory protein P-II Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
P11671 3.85e-47 149 65 0 112 1 glnB Nitrogen regulatory protein P-II Klebsiella oxytoca
P13556 5.01e-47 149 63 0 112 3 glnB Nitrogen regulatory protein P-II Rhodobacter capsulatus
P0AC58 5.53e-47 149 58 0 112 3 glnK Nitrogen regulatory protein GlnK Shigella flexneri
P0AC55 5.53e-47 149 58 0 112 1 glnK Nitrogen regulatory protein GlnK Escherichia coli (strain K12)
P0AC56 5.53e-47 149 58 0 112 3 glnK Nitrogen regulatory protein GlnK Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AC57 5.53e-47 149 58 0 112 3 glnK Nitrogen regulatory protein GlnK Escherichia coli O157:H7
P14179 2.4e-45 145 63 0 112 3 glnB Nitrogen regulatory protein P-II Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q98N18 5.51e-45 144 61 0 112 3 glnB Nitrogen regulatory protein P-II Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
P21193 1.02e-44 143 60 0 112 3 glnB Nitrogen regulatory protein P-II Azospirillum brasilense
Q53044 3.18e-44 142 61 0 112 3 glnB Nitrogen regulatory protein P-II Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q52905 7.56e-44 141 59 0 112 3 glnB Nitrogen regulatory protein P-II Rhizobium meliloti (strain 1021)
P43519 4.13e-43 139 57 0 112 3 glnB Nitrogen regulatory protein P-II Cereibacter sphaeroides
O66513 4.91e-42 137 56 0 112 1 glnB Nitrogen regulatory protein P-II Aquifex aeolicus (strain VF5)
P9WN31 1.29e-41 135 52 0 112 1 glnB Nitrogen regulatory protein P-II Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WN30 1.29e-41 135 52 0 112 3 glnB Nitrogen regulatory protein P-II Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P64250 1.29e-41 135 52 0 112 3 glnB Nitrogen regulatory protein P-II Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q47894 3.97e-40 132 57 0 112 3 glnB Nitrogen regulatory protein P-II Microchaete diplosiphon
P09827 4.16e-40 132 58 1 112 3 glnB Nitrogen regulatory protein P-II Rhizobium leguminosarum bv. viciae
P0A3F5 6.29e-40 131 59 0 112 1 glnB Nitrogen regulatory protein P-II Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
P0A3F4 6.29e-40 131 59 0 112 1 glnB Nitrogen regulatory protein P-II Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
O30794 1.05e-39 130 56 0 112 3 glnB Nitrogen regulatory protein P-II Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
O26760 8.23e-38 126 55 0 112 3 MTH_664 Nitrogen regulatory protein P-II 2 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q55247 4.95e-37 124 54 0 112 1 glnB Nitrogen regulatory protein P-II Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
O26758 9.99e-35 118 54 0 112 3 MTH_662 Nitrogen regulatory protein P-II 1 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
P51254 4.03e-33 114 54 0 112 3 glnB Nitrogen regulatory protein P-II Porphyra purpurea
O29284 3.41e-32 112 50 0 108 1 glnK1 Nitrogen regulatory protein GlnK1 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
O28524 2.07e-31 110 49 0 108 1 glnK3 Nitrogen regulatory protein GlnK3 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q1XDN3 2.19e-30 107 53 0 112 3 glnB Nitrogen regulatory protein P-II Neopyropia yezoensis
Q60381 5.47e-30 106 47 0 112 1 glnK1 Nitrogen regulatory protein GlnK1 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q58740 1.57e-28 102 45 0 112 3 glnK2 Nitrogen regulatory protein GlnK2 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O28527 2.2e-27 99 45 0 112 1 glnK2 Nitrogen regulatory protein GlnK2 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q9TM37 7.86e-26 95 43 0 107 3 glnB Nitrogen regulatory protein P-II Cyanidium caldarium
B8ZYW0 2.05e-25 95 42 0 112 1 glnK1 Nitrogen regulatory protein GlnK1 Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4)
P0CW45 7.09e-25 93 48 1 104 3 glnBI Nitrogen fixation nifHD region glnB-like protein 1 Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q9ZST4 2.34e-24 94 44 1 109 1 GLB1 Nitrogen regulatory protein P-II homolog Arabidopsis thaliana
P0CW44 1.29e-23 90 47 1 104 1 glnBI Nitrogen fixation nifHD region glnB-like protein 1 Methanococcus maripaludis
Q50786 2.59e-23 89 46 1 107 3 glnBA Nitrogen fixation nifHD region GlnB-like protein 1 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
P51604 2.23e-22 87 40 1 121 3 glnBB Nitrogen fixation nifHD region GlnB-like protein 2 Methanobacterium ivanovii
Q6AUR2 4.91e-22 89 41 1 109 2 GLB Nitrogen regulatory protein P-II homolog Oryza sativa subsp. japonica
B8ZYW1 3.32e-21 84 41 0 112 1 glnK2 Nitrogen regulatory protein GlnK2 Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4)
P25771 4.45e-21 83 47 2 106 3 glnBA Nitrogen fixation nifHD region GlnB-like protein 1 Methanothermococcus thermolithotrophicus
Q8PYW7 7.06e-21 83 42 1 114 1 glnK1 Nitrogen regulatory protein GlnK1 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q07428 3.63e-20 81 37 0 112 1 nrgB Nitrogen regulatory PII-like protein Bacillus subtilis (strain 168)
P54806 3.69e-20 82 38 1 120 3 None Nitrogen fixation nifHD2 region GlnB-like protein 2 Methanosarcina barkeri
P54809 1.33e-19 80 37 3 122 3 glnBB Nitrogen fixation nifHD1 region GlnB-like protein 2 Methanosarcina barkeri
P54807 1.55e-19 79 42 1 107 3 None Nitrogen fixation nifHD2 region GlnB-like protein 1 Methanosarcina barkeri
P54808 1.5e-18 77 45 2 107 3 glnBA Nitrogen fixation nifHD1 region GlnB-like protein 1 Methanosarcina barkeri
P51603 6.6e-17 73 45 1 104 3 glnBA Nitrogen fixation nifHD region GlnB-like protein 1 Methanobacterium ivanovii
P0CW47 2.64e-16 72 35 2 122 3 glnBII Nitrogen fixation nifHD region glnB-like protein 2 Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
P0CW46 2.64e-16 72 35 2 122 1 glnBII Nitrogen fixation nifHD region glnB-like protein 2 Methanococcus maripaludis
Q50787 3.32e-16 71 33 1 121 3 glnBB Nitrogen fixation nifHD region GlnB-like protein 2 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
P25770 1.96e-14 67 33 2 126 3 glnBB Nitrogen fixation nifHD region GlnB-like protein 2 Methanothermococcus thermolithotrophicus

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_17105
Feature type CDS
Gene glnK
Product Nitrogen regulatory protein PII
Location 26343 - 26681 (strand: 1)
Length 339 (nucleotides) / 112 (amino acids)

Contig

Accession ZDB_699
Length 56187 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_40
Orthogroup size 14
N. genomes 7

Actions

Genomic region

Domains

PF00543 Nitrogen regulatory protein P-II

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0347 Signal transduction mechanisms (T)
Amino acid transport and metabolism (E)		 TE Nitrogen regulatory protein PII

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K04751 nitrogen regulatory protein P-II 1 Two-component system -

Protein Sequence

MKMIMAIIKPFKLNDVRDALNEEGIQGLTVLEVRGAGRQKGHTELYRGEEYSTDFLPKTQLTIVVPDDSLDRIIEAICRSAYTGSIGDGKIFVSDITQAVRIRTGEQNDEAI

Flanking regions ( +/- flanking 50bp)

ACTTTTGCAATTTGTCCTCAGGACACCAGCAACCTGAAGCGGAGAATGCGATGAAAATGATAATGGCCATCATCAAGCCTTTTAAACTTAATGACGTCAGAGATGCGCTGAACGAAGAGGGTATTCAGGGATTAACTGTACTGGAAGTACGGGGTGCGGGCAGACAGAAGGGGCACACTGAGCTGTACCGGGGGGAAGAGTACAGCACGGATTTTCTGCCGAAGACGCAGCTTACGATTGTTGTGCCTGATGATTCTCTTGATCGCATTATTGAGGCAATTTGCCGCTCGGCATACACCGGCAGTATCGGTGACGGGAAAATATTTGTTTCAGACATTACTCAGGCGGTGCGGATCCGTACCGGTGAACAAAATGATGAAGCTATTTAAACCGCGCGGAGATGCTCAGATGATGAAACGAAAAATGGTCTTGCCTGTTG