Homologs in group_40

Help

13 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15935 FBDBKF_15935 67.0 Morganella morganii S1 glnK Nitrogen regulatory protein PII
EHELCC_00370 EHELCC_00370 100.0 Morganella morganii S2 glnB nitrogen regulatory protein P-II
EHELCC_18535 EHELCC_18535 67.0 Morganella morganii S2 glnK Nitrogen regulatory protein PII
NLDBIP_03090 NLDBIP_03090 100.0 Morganella morganii S4 glnB nitrogen regulatory protein P-II
NLDBIP_17370 NLDBIP_17370 67.0 Morganella morganii S4 glnK Nitrogen regulatory protein PII
LHKJJB_04605 LHKJJB_04605 100.0 Morganella morganii S3 glnB nitrogen regulatory protein P-II
LHKJJB_17290 LHKJJB_17290 67.0 Morganella morganii S3 glnK Nitrogen regulatory protein PII
HKOGLL_02440 HKOGLL_02440 100.0 Morganella morganii S5 glnB nitrogen regulatory protein P-II
HKOGLL_17105 HKOGLL_17105 67.0 Morganella morganii S5 glnK Nitrogen regulatory protein PII
F4V73_RS07245 F4V73_RS07245 96.4 Morganella psychrotolerans glnB nitrogen regulatory protein P-II
F4V73_RS16375 F4V73_RS16375 67.9 Morganella psychrotolerans - P-II family nitrogen regulator
PMI_RS00610 PMI_RS00610 66.1 Proteus mirabilis HI4320 - P-II family nitrogen regulator
PMI_RS09230 PMI_RS09230 92.9 Proteus mirabilis HI4320 glnB nitrogen regulatory protein P-II

Distribution of the homologs in the orthogroup group_40

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_40

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P11671 8.05e-68 202 89 0 112 1 glnB Nitrogen regulatory protein P-II Klebsiella oxytoca
P0A9Z6 9.39e-68 202 89 0 112 3 glnB Nitrogen regulatory protein P-II 1 Shigella flexneri
P0A9Z4 9.39e-68 202 89 0 112 3 glnB Nitrogen regulatory protein P-II 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A9Z5 9.39e-68 202 89 0 112 3 glnB Nitrogen regulatory protein P-II 1 Salmonella typhi
P0A9Z1 9.39e-68 202 89 0 112 1 glnB Nitrogen regulatory protein P-II 1 Escherichia coli (strain K12)
P0A9Z2 9.39e-68 202 89 0 112 3 glnB Nitrogen regulatory protein P-II 1 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9Z3 9.39e-68 202 89 0 112 3 glnB Nitrogen regulatory protein P-II 1 Escherichia coli O157:H7
Q9CJK1 3.6e-64 192 82 0 112 3 glnB Nitrogen regulatory protein P-II Pasteurella multocida (strain Pm70)
P43795 2.97e-61 185 75 0 112 3 glnB Nitrogen regulatory protein P-II Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P21193 8.57e-55 169 75 0 112 3 glnB Nitrogen regulatory protein P-II Azospirillum brasilense
Q53044 8.67e-55 169 71 0 112 3 glnB Nitrogen regulatory protein P-II Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q52905 1.4e-54 168 73 0 112 3 glnB Nitrogen regulatory protein P-II Rhizobium meliloti (strain 1021)
Q98N18 2.25e-54 168 72 0 112 3 glnB Nitrogen regulatory protein P-II Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
P14179 3.16e-54 167 71 0 112 3 glnB Nitrogen regulatory protein P-II Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
O66513 1.53e-53 166 72 0 112 1 glnB Nitrogen regulatory protein P-II Aquifex aeolicus (strain VF5)
P43519 1.81e-53 166 70 0 112 3 glnB Nitrogen regulatory protein P-II Cereibacter sphaeroides
P13556 1.66e-51 160 68 0 112 3 glnB Nitrogen regulatory protein P-II Rhodobacter capsulatus
P09827 2.28e-50 157 70 1 112 3 glnB Nitrogen regulatory protein P-II Rhizobium leguminosarum bv. viciae
P0AC58 5.72e-50 157 66 0 112 3 glnK Nitrogen regulatory protein GlnK Shigella flexneri
P0AC55 5.72e-50 157 66 0 112 1 glnK Nitrogen regulatory protein GlnK Escherichia coli (strain K12)
P0AC56 5.72e-50 157 66 0 112 3 glnK Nitrogen regulatory protein GlnK Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AC57 5.72e-50 157 66 0 112 3 glnK Nitrogen regulatory protein GlnK Escherichia coli O157:H7
O54053 9.17e-50 156 65 0 112 3 glnB Nitrogen regulatory protein P-II Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
P9WN31 3.8e-46 147 59 0 112 1 glnB Nitrogen regulatory protein P-II Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WN30 3.8e-46 147 59 0 112 3 glnB Nitrogen regulatory protein P-II Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P64250 3.8e-46 147 59 0 112 3 glnB Nitrogen regulatory protein P-II Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P0A3F5 1.82e-45 145 64 0 112 1 glnB Nitrogen regulatory protein P-II Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
P0A3F4 1.82e-45 145 64 0 112 1 glnB Nitrogen regulatory protein P-II Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q47894 2.73e-45 145 62 0 112 3 glnB Nitrogen regulatory protein P-II Microchaete diplosiphon
O30794 7.25e-45 144 61 0 112 3 glnB Nitrogen regulatory protein P-II Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q55247 1.58e-43 140 62 0 112 1 glnB Nitrogen regulatory protein P-II Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
O26760 1.99e-39 130 60 0 112 3 MTH_664 Nitrogen regulatory protein P-II 2 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
O26758 2.06e-37 125 59 0 112 3 MTH_662 Nitrogen regulatory protein P-II 1 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
P51254 1.5e-35 120 58 0 112 3 glnB Nitrogen regulatory protein P-II Porphyra purpurea
Q60381 4.25e-35 119 53 0 112 1 glnK1 Nitrogen regulatory protein GlnK1 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q58740 6.59e-35 119 53 0 112 3 glnK2 Nitrogen regulatory protein GlnK2 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q9ZST4 3.16e-32 114 50 1 110 1 GLB1 Nitrogen regulatory protein P-II homolog Arabidopsis thaliana
O29284 2.31e-31 110 53 0 108 1 glnK1 Nitrogen regulatory protein GlnK1 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q1XDN3 6.29e-31 108 56 0 112 3 glnB Nitrogen regulatory protein P-II Neopyropia yezoensis
O28524 8.93e-31 108 52 0 108 1 glnK3 Nitrogen regulatory protein GlnK3 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
O28527 4.08e-30 106 52 0 112 1 glnK2 Nitrogen regulatory protein GlnK2 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q6AUR2 4.19e-30 109 50 1 110 2 GLB Nitrogen regulatory protein P-II homolog Oryza sativa subsp. japonica
Q9TM37 2.63e-29 104 49 0 111 3 glnB Nitrogen regulatory protein P-II Cyanidium caldarium
Q8PYW7 1.44e-26 97 43 1 114 1 glnK1 Nitrogen regulatory protein GlnK1 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
B8ZYW0 1.88e-26 97 48 0 112 1 glnK1 Nitrogen regulatory protein GlnK1 Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4)
Q07428 4.53e-25 94 38 0 112 1 nrgB Nitrogen regulatory PII-like protein Bacillus subtilis (strain 168)
B8ZYW1 6.13e-25 94 47 0 112 1 glnK2 Nitrogen regulatory protein GlnK2 Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4)
P51604 2.23e-21 85 41 1 121 3 glnBB Nitrogen fixation nifHD region GlnB-like protein 2 Methanobacterium ivanovii
P54806 1.31e-18 77 38 1 120 3 None Nitrogen fixation nifHD2 region GlnB-like protein 2 Methanosarcina barkeri
P54809 2.46e-17 74 35 2 122 3 glnBB Nitrogen fixation nifHD1 region GlnB-like protein 2 Methanosarcina barkeri
P0CW45 2.8e-17 73 42 1 104 3 glnBI Nitrogen fixation nifHD region glnB-like protein 1 Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
P0CW44 6.3e-16 70 41 1 104 1 glnBI Nitrogen fixation nifHD region glnB-like protein 1 Methanococcus maripaludis
Q50787 9.58e-16 70 35 2 124 3 glnBB Nitrogen fixation nifHD region GlnB-like protein 2 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q50786 4.59e-15 68 42 1 107 3 glnBA Nitrogen fixation nifHD region GlnB-like protein 1 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
P0CW47 5.58e-15 68 34 2 122 3 glnBII Nitrogen fixation nifHD region glnB-like protein 2 Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
P0CW46 5.58e-15 68 34 2 122 1 glnBII Nitrogen fixation nifHD region glnB-like protein 2 Methanococcus maripaludis
P25771 6.56e-15 67 38 1 106 3 glnBA Nitrogen fixation nifHD region GlnB-like protein 1 Methanothermococcus thermolithotrophicus
P54808 1.88e-13 64 41 2 107 3 glnBA Nitrogen fixation nifHD1 region GlnB-like protein 1 Methanosarcina barkeri
P25770 3.86e-13 63 34 1 126 3 glnBB Nitrogen fixation nifHD region GlnB-like protein 2 Methanothermococcus thermolithotrophicus
P54807 1.1e-11 59 35 1 107 3 None Nitrogen fixation nifHD2 region GlnB-like protein 1 Methanosarcina barkeri
P51603 1.61e-11 59 38 1 104 3 glnBA Nitrogen fixation nifHD region GlnB-like protein 1 Methanobacterium ivanovii

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_01175
Feature type CDS
Gene glnB
Product nitrogen regulatory protein P-II
Location 218850 - 219188 (strand: -1)
Length 339 (nucleotides) / 112 (amino acids)

Contig

Accession contig_1
Length 309072 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_40
Orthogroup size 14
N. genomes 7

Actions

Genomic region

Domains

PF00543 Nitrogen regulatory protein P-II

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0347 Signal transduction mechanisms (T)
Amino acid transport and metabolism (E)		 TE Nitrogen regulatory protein PII

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K04752 nitrogen regulatory protein P-II 2 - -

Protein Sequence

MKKIEAIIKPFKLDDVREALAEVGITGMTVTEVKGFGRQKGHTELYRGAEYMVDFLPKVKIEIVVADDILETCVETIMQTAQTGKIGDGKIFVFDVAQVVRIRTGEQDEDAI

Flanking regions ( +/- flanking 50bp)

ACCCGATTACATCCGGGTTTGGCCGCAAAAATTGGTAACAGGATCTGACAATGAAAAAGATTGAGGCAATTATTAAGCCGTTTAAACTCGATGATGTCCGCGAAGCTCTGGCCGAAGTGGGGATCACCGGGATGACCGTGACAGAAGTGAAGGGGTTCGGCCGTCAGAAAGGGCATACGGAACTGTATCGCGGTGCGGAATATATGGTGGATTTTCTGCCGAAGGTAAAAATTGAAATTGTTGTCGCCGATGACATTCTGGAAACCTGTGTGGAAACCATTATGCAGACGGCGCAGACCGGTAAAATCGGTGACGGTAAAATCTTTGTGTTCGATGTGGCACAGGTTGTCCGGATCCGTACCGGGGAACAGGATGAAGATGCTATCTGAGTTCTGCTGAGCATCCCTGAAAATCAAACGTATCCGGCGGCTGTTATTTC