Homologs in group_2165

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16290 FBDBKF_16290 100.0 Morganella morganii S1 rfaB Glycosyltransferase involved in cell wall bisynthesis
EHELCC_16325 EHELCC_16325 100.0 Morganella morganii S2 rfaB Glycosyltransferase involved in cell wall bisynthesis
NLDBIP_17015 NLDBIP_17015 100.0 Morganella morganii S4 rfaB Glycosyltransferase involved in cell wall bisynthesis
LHKJJB_16935 LHKJJB_16935 100.0 Morganella morganii S3 rfaB Glycosyltransferase involved in cell wall bisynthesis
F4V73_RS17300 F4V73_RS17300 86.1 Morganella psychrotolerans - glycosyltransferase family 4 protein
PMI_RS15670 PMI_RS15670 69.6 Proteus mirabilis HI4320 - glycosyltransferase family 4 protein

Distribution of the homologs in the orthogroup group_2165

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2165

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9R9N1 4.58e-22 99 25 9 358 3 lpsE Lipopolysaccharide core biosynthesis glycosyltransferase LpsE Rhizobium meliloti (strain 1021)
Q9R9N0 1.79e-18 89 26 15 379 3 lpsD Lipopolysaccharide core biosynthesis glycosyltransferase LpsD Rhizobium meliloti (strain 1021)
Q81ST7 4.23e-16 82 31 3 188 1 bshA N-acetyl-alpha-D-glucosaminyl L-malate synthase Bacillus anthracis
Q59002 5.16e-16 82 30 4 179 3 MJ1607 Uncharacterized glycosyltransferase MJ1607 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P25740 3.59e-15 79 24 8 331 1 waaG Lipopolysaccharide glucosyltransferase WaaG Escherichia coli (strain K12)
P9WMY9 5.3e-14 76 31 7 205 1 Rv3032 Glycogen synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMY8 5.3e-14 76 31 7 205 3 MT3116 Glycogen synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
B1VEI4 5.88e-14 76 24 16 409 3 mshA D-inositol 3-phosphate glycosyltransferase Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
A0QQZ8 2.53e-13 74 23 10 385 1 mshA D-inositol 3-phosphate glycosyltransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q8NTA6 8.06e-13 72 23 14 420 1 mshA D-inositol 3-phosphate glycosyltransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QB40 8.06e-13 72 23 14 420 3 mshA D-inositol 3-phosphate glycosyltransferase Corynebacterium glutamicum (strain R)
C7QKE8 9.63e-12 69 22 12 404 3 mshA2 D-inositol 3-phosphate glycosyltransferase 2 Catenulispora acidiphila (strain DSM 44928 / JCM 14897 / NBRC 102108 / NRRL B-24433 / ID139908)
A7TZT2 1.73e-11 68 25 10 244 1 mfpsA Mannosylfructose-phosphate synthase Agrobacterium fabrum (strain C58 / ATCC 33970)
P42982 2.39e-11 68 29 4 188 1 bshA N-acetyl-alpha-D-glucosaminyl L-malate synthase Bacillus subtilis (strain 168)
O34413 3.55e-11 67 26 13 283 3 ytcC Putative glycosyltransferase YtcC Bacillus subtilis (strain 168)
A1T3B5 4.83e-11 67 23 12 395 3 mshA D-inositol 3-phosphate glycosyltransferase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
A3PU84 4.97e-11 67 23 11 385 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium sp. (strain JLS)
C3PK12 6.85e-11 67 22 15 416 3 mshA D-inositol 3-phosphate glycosyltransferase Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q2SZV9 1.02e-10 66 26 7 237 3 BTH_I0986 Probable transglycosylase BTH_I0986 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q8FSH1 2.23e-10 65 23 12 407 3 mshA D-inositol 3-phosphate glycosyltransferase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q8NT41 2.86e-10 65 29 5 200 1 mgtA GDP-mannose-dependent alpha-mannosyltransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A0LQY9 4.27e-10 64 22 10 359 3 mshA D-inositol 3-phosphate glycosyltransferase Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
P9WMY7 4.8e-10 64 23 11 365 1 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMY6 4.8e-10 64 23 11 365 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
C6DT68 4.8e-10 64 23 11 365 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium tuberculosis (strain KZN 1435 / MDR)
A5WJJ8 4.8e-10 64 23 11 365 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium tuberculosis (strain F11)
A5TZL4 4.8e-10 64 23 11 365 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AKG4 4.8e-10 64 23 11 365 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KFW0 4.8e-10 64 23 11 365 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P64708 4.8e-10 64 23 11 365 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q4JSW2 4.81e-10 64 23 15 409 3 mshA D-inositol 3-phosphate glycosyltransferase Corynebacterium jeikeium (strain K411)
P39862 4.83e-10 64 26 7 220 3 capM Capsular polysaccharide biosynthesis glycosyltransferase CapM Staphylococcus aureus
C8XA09 7.13e-10 63 24 16 390 3 mshA D-inositol 3-phosphate glycosyltransferase Nakamurella multipartita (strain ATCC 700099 / DSM 44233 / CIP 104796 / JCM 9543 / NBRC 105858 / Y-104)
Q0P9C9 8.87e-10 63 27 7 224 1 pglA N,N'-diacetylbacillosaminyl-diphospho-undecaprenol alpha-1,3-N-acetylgalactosaminyltransferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8LDJ8 1.03e-09 63 23 11 313 3 mshA D-inositol 3-phosphate glycosyltransferase Parafrankia sp. (strain EAN1pec)
A4FQ08 1.07e-09 63 22 7 309 3 mshA D-inositol 3-phosphate glycosyltransferase Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
P71053 1.27e-09 62 25 3 199 2 epsD Putative glycosyltransferase EpsD Bacillus subtilis (strain 168)
P54138 1.29e-09 63 24 12 351 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium leprae (strain TN)
B8ZT88 1.29e-09 63 24 12 351 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium leprae (strain Br4923)
P46915 2.4e-09 62 23 10 235 1 cotSA Spore coat protein SA Bacillus subtilis (strain 168)
D6Y4U7 4.94e-09 61 26 6 208 3 mshA D-inositol 3-phosphate glycosyltransferase Thermobispora bispora (strain ATCC 19993 / DSM 43833 / CBS 139.67 / JCM 10125 / KCTC 9307 / NBRC 14880 / R51)
Q1BEA6 5.58e-09 61 23 11 385 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium sp. (strain MCS)
A1UAM8 5.58e-09 61 23 11 385 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium sp. (strain KMS)
B2HQV2 5.99e-09 61 23 9 347 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium marinum (strain ATCC BAA-535 / M)
C1AZ64 8.62e-09 60 25 14 344 3 mshA D-inositol 3-phosphate glycosyltransferase Rhodococcus opacus (strain B4)
D7AW65 1.04e-08 60 25 12 344 3 mshA D-inositol 3-phosphate glycosyltransferase Nocardiopsis dassonvillei (strain ATCC 23218 / DSM 43111 / CIP 107115 / JCM 7437 / KCTC 9190 / NBRC 14626 / NCTC 10488 / NRRL B-5397 / IMRU 509)
Q6NJL3 1.16e-08 60 22 14 385 3 mshA D-inositol 3-phosphate glycosyltransferase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
D3Q051 1.33e-08 60 22 14 416 3 mshA D-inositol 3-phosphate glycosyltransferase Stackebrandtia nassauensis (strain DSM 44728 / CIP 108903 / NRRL B-16338 / NBRC 102104 / LLR-40K-21)
P9WMZ1 1.72e-08 59 26 10 249 1 glgM Alpha-maltose-1-phosphate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMZ0 1.72e-08 59 26 10 249 3 glgM Alpha-maltose-1-phosphate synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
D2S4K7 3.03e-08 58 24 13 354 3 mshA D-inositol 3-phosphate glycosyltransferase Geodermatophilus obscurus (strain ATCC 25078 / DSM 43160 / JCM 3152 / CCUG 61914 / KCC A-0152 / KCTC 9177 / NBRC 13315 / NRRL B-3577 / G-20)
D7C367 4.61e-08 58 22 10 362 3 mshA D-inositol 3-phosphate glycosyltransferase Streptomyces bingchenggensis (strain BCW-1)
Q0SF06 4.92e-08 58 24 14 344 3 mshA D-inositol 3-phosphate glycosyltransferase Rhodococcus jostii (strain RHA1)
Q58577 5.76e-08 57 21 12 328 3 MJ1178 Uncharacterized glycosyltransferase MJ1178 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q58459 7.18e-08 57 24 4 184 3 MJ1059 Uncharacterized glycosyltransferase MJ1059 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A8LZG1 7.69e-08 57 23 12 329 3 mshA D-inositol 3-phosphate glycosyltransferase Salinispora arenicola (strain CNS-205)
A0PVZ1 9.51e-08 57 23 9 347 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium ulcerans (strain Agy99)
P9WMZ3 9.64e-08 57 27 7 177 1 pimB GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMZ2 9.64e-08 57 27 7 177 3 pimB GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A4X1R6 9.8e-08 57 20 14 399 3 mshA D-inositol 3-phosphate glycosyltransferase Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
D1A4Q3 1e-07 57 25 5 208 3 mshA D-inositol 3-phosphate glycosyltransferase Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9)
B5T072 1.13e-07 57 21 5 231 1 wclR UDP-Gal:alpha-D-GlcNAc-diphosphoundecaprenol alpha-1,3-galactosyltransferase Escherichia coli
C6WPK3 1.36e-07 56 23 12 357 3 mshA D-inositol 3-phosphate glycosyltransferase Actinosynnema mirum (strain ATCC 29888 / DSM 43827 / JCM 3225 / NBRC 14064 / NCIMB 13271 / NRRL B-12336 / IMRU 3971 / 101)
B1MHQ0 1.46e-07 56 21 7 312 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
O05083 1.56e-07 56 26 3 153 3 HI_1698 Uncharacterized glycosyltransferase HI_1698 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A0R043 1.59e-07 56 26 6 177 1 pimB GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q82G92 1.61e-07 56 21 12 377 3 mshA D-inositol 3-phosphate glycosyltransferase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
C7MSY6 2.66e-07 55 22 10 314 3 mshA D-inositol 3-phosphate glycosyltransferase Saccharomonospora viridis (strain ATCC 15386 / DSM 43017 / JCM 3036 / CCUG 5913 / NBRC 12207 / NCIMB 9602 / P101)
B1VS68 3.96e-07 55 21 10 355 3 mshA D-inositol 3-phosphate glycosyltransferase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
A0R2E2 4.68e-07 55 24 8 245 1 glgM Alpha-maltose-1-phosphate synthase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
C4LLD6 5.09e-07 55 23 5 238 3 mshA D-inositol 3-phosphate glycosyltransferase Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
C9ZH13 5.23e-07 55 21 11 352 3 mshA D-inositol 3-phosphate glycosyltransferase Streptomyces scabiei (strain 87.22)
D5UJ42 6.8e-07 54 24 9 254 3 mshA D-inositol 3-phosphate glycosyltransferase Cellulomonas flavigena (strain ATCC 482 / DSM 20109 / BCRC 11376 / JCM 18109 / NBRC 3775 / NCIMB 8073 / NRS 134)
Q47KS6 1.64e-06 53 22 4 194 3 mshA D-inositol 3-phosphate glycosyltransferase Thermobifida fusca (strain YX)
Q65CC7 1.83e-06 53 26 7 193 1 kanE Alpha-D-kanosaminyltransferase Streptomyces kanamyceticus
D0L476 2.43e-06 52 23 10 354 3 mshA D-inositol 3-phosphate glycosyltransferase Gordonia bronchialis (strain ATCC 25592 / DSM 43247 / BCRC 13721 / JCM 3198 / KCTC 3076 / NBRC 16047 / NCTC 10667)
Q9R9N2 2.64e-06 52 25 5 180 3 lpsB Lipopolysaccharide core biosynthesis mannosyltransferase LpsB Rhizobium meliloti (strain 1021)
Q04975 3.22e-06 52 26 4 191 4 vipC Vi polysaccharide biosynthesis protein VipC/TviE Salmonella typhi
D1BD84 3.34e-06 52 23 4 192 3 mshA D-inositol 3-phosphate glycosyltransferase Sanguibacter keddieii (strain ATCC 51767 / DSM 10542 / NCFB 3025 / ST-74)
Q9FCG5 3.65e-06 52 20 11 383 2 mshA D-inositol 3-phosphate glycosyltransferase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
C0ZUT0 4.14e-06 52 25 7 221 3 mshA D-inositol 3-phosphate glycosyltransferase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
P26470 8.28e-06 51 24 6 205 1 waaK Lipopolysaccharide 1,2-N-acetylglucosaminetransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A4T324 9.19e-06 51 22 12 385 3 mshA D-inositol 3-phosphate glycosyltransferase Mycolicibacterium gilvum (strain PYR-GCK)
A6W6D9 1.13e-05 50 23 4 176 3 mshA D-inositol 3-phosphate glycosyltransferase Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
D5USX8 1.67e-05 50 22 15 399 3 mshA D-inositol 3-phosphate glycosyltransferase Tsukamurella paurometabola (strain ATCC 8368 / DSM 20162 / CCUG 35730 / CIP 100753 / JCM 10117 / KCTC 9821 / NBRC 16120 / NCIMB 702349 / NCTC 13040)
D1BZ82 2.77e-05 49 23 6 211 3 mshA D-inositol 3-phosphate glycosyltransferase Xylanimonas cellulosilytica (strain DSM 15894 / JCM 12276 / CECT 5975 / KCTC 9989 / LMG 20990 / NBRC 107835 / XIL07)
Q9L1I4 7.27e-05 48 25 6 203 3 SCO2592 Exopolysaccharide phosphotransferase SCO2592 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q42857 8.78e-05 48 25 5 198 2 WAXY Granule-bound starch synthase 1, chloroplastic/amyloplastic Ipomoea batatas
Q8NNK8 9.27e-05 47 24 5 184 1 pimB GDP-mannose-dependent monoacylated alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
B8HCF8 0.000115 47 21 13 357 3 mshA D-inositol 3-phosphate glycosyltransferase Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
Q47595 0.000131 47 21 14 389 1 wbdC O-antigen chain mannosyltransferase C Escherichia coli
Q2JFV0 0.000172 47 21 8 275 3 mshA D-inositol 3-phosphate glycosyltransferase Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q47594 0.000176 47 23 10 227 1 wbdB O-antigen chain mannosyltransferase B Escherichia coli
D2Q1C4 0.000177 47 22 5 208 3 mshA D-inositol 3-phosphate glycosyltransferase Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399)
P26388 0.000286 46 20 8 280 3 wcaL Putative colanic acid biosynthesis glycosyltransferase WcaL Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q0P9C7 0.000319 46 20 4 183 1 pglJ N-acetylgalactosamine-N,N'-diacetylbacillosaminyl-diphospho-undecaprenol 4-alpha-N-acetylgalactosaminyltransferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q9LXL5 0.000323 46 34 3 97 1 SUS4 Sucrose synthase 4 Arabidopsis thaliana
A6ZW78 0.00039 45 24 6 202 3 SPT14 Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit Saccharomyces cerevisiae (strain YJM789)
A1R8N8 0.000541 45 23 5 202 3 mshA D-inositol 3-phosphate glycosyltransferase Paenarthrobacter aurescens (strain TC1)
P54490 0.000556 45 21 16 381 3 yqgM Uncharacterized glycosyltransferase YqgM Bacillus subtilis (strain 168)
D6Z995 0.000598 45 23 14 342 3 mshA D-inositol 3-phosphate glycosyltransferase Segniliparus rotundus (strain ATCC BAA-972 / CDC 1076 / CIP 108378 / DSM 44985 / JCM 13578)
A0QWG6 0.000687 45 26 11 242 1 pimA Phosphatidyl-myo-inositol mannosyltransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
C7Q4Y6 0.000722 45 22 5 208 3 mshA1 D-inositol 3-phosphate glycosyltransferase 1 Catenulispora acidiphila (strain DSM 44928 / JCM 14897 / NBRC 102108 / NRRL B-24433 / ID139908)
Q53U18 0.000827 45 21 6 253 1 neoD 2-deoxystreptamine N-acetyl-D-glucosaminyltransferase Streptomyces fradiae

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_16905
Feature type CDS
Gene rfaB
Product Glycosyltransferase involved in cell wall bisynthesis
Location 45531 - 46658 (strand: 1)
Length 1128 (nucleotides) / 375 (amino acids)

Contig

Accession ZDB_698
Length 62170 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2165
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00534 Glycosyl transferases group 1
PF13439 Glycosyltransferase Family 4

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0438 Cell wall/membrane/envelope biogenesis (M) M Glycosyltransferase involved in cell wall bisynthesis

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02844 UDP-glucose:(heptosyl)LPS alpha-1,3-glucosyltransferase [EC:2.4.1.-] Lipopolysaccharide biosynthesis
Metabolic pathways		 -

Protein Sequence

MKNMRLAIVRQKYRPDGGAERFVSRALEALDNRNLELNVITRSWQGAAAPGWYIHVVNPPKWGRISRERGFANAARACWQNEKFDIVQSHERIAGCDIFRAGDGVHRRWLLQRARVLPAWRAKLLFASPYHRYVMKAEQEMYHDPHFKQVICNSEMVKKEVMEDFGLSESQITVIYNGIDSEKFHPLPESERLALRQTYQIPAAAKCLVYVGSGFERKGLAAAIMAVSRNDAYLLVVGQDKAEKKYRQLAASLGCADRIRFAGMQKQTLPFYQMSDGLLLPTLYDPFPNVVPEAMACALPVITSTTCGGAEFISQGEEGFVCDALDIGGLAEAVSQLPCDHLSSRMSECARQRVLPYTPAALSQQLIDLYGRVLA

Flanking regions ( +/- flanking 50bp)

CTGAGTCCGATTCCGGCAGACGCAGTGATTACCGCGGCACGGAGATATTTATGAAAAATATGCGTCTGGCGATTGTTCGTCAGAAATACCGCCCGGACGGCGGCGCGGAGCGTTTTGTATCCCGGGCGCTGGAAGCACTGGACAACCGGAATCTGGAGCTGAATGTTATCACCCGTTCCTGGCAGGGTGCTGCGGCTCCCGGCTGGTATATTCATGTGGTGAATCCGCCGAAATGGGGACGGATCAGCCGTGAACGGGGATTTGCCAACGCTGCCCGTGCCTGCTGGCAGAATGAAAAATTTGATATTGTTCAGAGCCATGAACGCATTGCCGGCTGTGATATTTTCCGGGCCGGGGACGGTGTGCACCGCCGCTGGCTGTTACAGCGGGCGCGGGTACTGCCCGCCTGGCGGGCAAAACTGTTGTTTGCCTCGCCGTACCACCGTTATGTGATGAAGGCGGAGCAGGAGATGTACCATGATCCGCACTTTAAGCAGGTGATTTGTAATTCGGAAATGGTAAAAAAAGAGGTGATGGAAGACTTTGGTTTGTCAGAGTCGCAAATAACCGTCATCTATAACGGGATTGATTCTGAAAAGTTCCATCCGCTGCCGGAATCAGAGCGTCTCGCGCTCCGGCAGACTTATCAGATCCCGGCGGCGGCAAAATGTCTGGTGTATGTCGGTTCCGGGTTTGAACGCAAAGGACTGGCGGCGGCGATTATGGCGGTCAGCCGCAATGATGCGTATCTGCTGGTGGTCGGTCAGGATAAGGCAGAAAAAAAATATCGACAGCTGGCAGCATCCCTGGGTTGTGCGGATCGCATCCGTTTTGCGGGTATGCAGAAACAGACACTGCCGTTTTATCAGATGAGTGACGGGCTGCTGCTGCCGACACTGTATGATCCGTTCCCGAATGTGGTACCCGAGGCGATGGCCTGCGCACTGCCGGTGATCACCAGTACCACCTGCGGCGGGGCGGAATTTATCTCACAGGGTGAAGAGGGTTTTGTCTGTGATGCGCTGGATATTGGCGGTCTGGCAGAGGCGGTCTCGCAACTGCCCTGTGATCACCTGAGCAGCCGGATGTCTGAATGTGCACGGCAGCGGGTTTTACCTTATACACCGGCGGCGTTATCACAGCAGCTTATCGATCTCTACGGGCGGGTCCTGGCATAATGAAACAGCATATTTTATTTATTATTGACGGTTTACCGGGCGGCGGTGCT