Homologs in group_2165

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16290 FBDBKF_16290 86.1 Morganella morganii S1 rfaB Glycosyltransferase involved in cell wall bisynthesis
EHELCC_16325 EHELCC_16325 86.1 Morganella morganii S2 rfaB Glycosyltransferase involved in cell wall bisynthesis
NLDBIP_17015 NLDBIP_17015 86.1 Morganella morganii S4 rfaB Glycosyltransferase involved in cell wall bisynthesis
LHKJJB_16935 LHKJJB_16935 86.1 Morganella morganii S3 rfaB Glycosyltransferase involved in cell wall bisynthesis
HKOGLL_16905 HKOGLL_16905 86.1 Morganella morganii S5 rfaB Glycosyltransferase involved in cell wall bisynthesis
PMI_RS15670 PMI_RS15670 69.7 Proteus mirabilis HI4320 - glycosyltransferase family 4 protein

Distribution of the homologs in the orthogroup group_2165

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2165

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q59002 4.02e-20 94 33 6 195 3 MJ1607 Uncharacterized glycosyltransferase MJ1607 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q9R9N1 5.29e-20 93 23 9 358 3 lpsE Lipopolysaccharide core biosynthesis glycosyltransferase LpsE Rhizobium meliloti (strain 1021)
P25740 2.99e-19 91 25 8 328 1 waaG Lipopolysaccharide glucosyltransferase WaaG Escherichia coli (strain K12)
Q81ST7 4.09e-19 91 31 4 189 1 bshA N-acetyl-alpha-D-glucosaminyl L-malate synthase Bacillus anthracis
B1VEI4 3.75e-18 89 25 15 413 3 mshA D-inositol 3-phosphate glycosyltransferase Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
Q8NTA6 2.49e-17 86 28 5 253 1 mshA D-inositol 3-phosphate glycosyltransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QB40 2.49e-17 86 28 5 253 3 mshA D-inositol 3-phosphate glycosyltransferase Corynebacterium glutamicum (strain R)
C3PK12 5.31e-16 82 24 10 325 3 mshA D-inositol 3-phosphate glycosyltransferase Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
P9WMY9 1.51e-15 80 32 5 192 1 Rv3032 Glycogen synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMY8 1.51e-15 80 32 5 192 3 MT3116 Glycogen synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8FSH1 5.46e-15 79 26 6 251 3 mshA D-inositol 3-phosphate glycosyltransferase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A0QQZ8 5.9e-15 79 24 13 397 1 mshA D-inositol 3-phosphate glycosyltransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q4JSW2 5.98e-14 76 26 6 249 3 mshA D-inositol 3-phosphate glycosyltransferase Corynebacterium jeikeium (strain K411)
Q2SZV9 7.94e-14 75 26 5 221 3 BTH_I0986 Probable transglycosylase BTH_I0986 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A4FQ08 2.43e-13 74 27 10 277 3 mshA D-inositol 3-phosphate glycosyltransferase Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
A7TZT2 4.31e-13 73 26 10 246 1 mfpsA Mannosylfructose-phosphate synthase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9R9N0 5.18e-13 72 24 16 376 3 lpsD Lipopolysaccharide core biosynthesis glycosyltransferase LpsD Rhizobium meliloti (strain 1021)
Q6NJL3 1.03e-12 72 23 7 277 3 mshA D-inositol 3-phosphate glycosyltransferase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q0P9C9 1.43e-12 71 25 5 223 1 pglA N,N'-diacetylbacillosaminyl-diphospho-undecaprenol alpha-1,3-N-acetylgalactosaminyltransferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A1T3B5 1.52e-12 72 24 10 327 3 mshA D-inositol 3-phosphate glycosyltransferase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
B5T072 1.61e-12 71 25 5 217 1 wclR UDP-Gal:alpha-D-GlcNAc-diphosphoundecaprenol alpha-1,3-galactosyltransferase Escherichia coli
P42982 3.47e-12 70 28 3 187 1 bshA N-acetyl-alpha-D-glucosaminyl L-malate synthase Bacillus subtilis (strain 168)
A3PU84 5.72e-12 70 24 10 318 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium sp. (strain JLS)
B2HQV2 6.35e-12 70 25 7 267 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium marinum (strain ATCC BAA-535 / M)
Q0SF06 9.56e-12 69 26 5 193 3 mshA D-inositol 3-phosphate glycosyltransferase Rhodococcus jostii (strain RHA1)
P46915 1.65e-11 68 24 9 235 1 cotSA Spore coat protein SA Bacillus subtilis (strain 168)
P9WMY7 2.29e-11 68 24 8 278 1 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMY6 2.29e-11 68 24 8 278 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
C6DT68 2.29e-11 68 24 8 278 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium tuberculosis (strain KZN 1435 / MDR)
A5WJJ8 2.29e-11 68 24 8 278 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium tuberculosis (strain F11)
A5TZL4 2.29e-11 68 24 8 278 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AKG4 2.29e-11 68 24 8 278 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KFW0 2.29e-11 68 24 8 278 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P64708 2.29e-11 68 24 8 278 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q73SU4 8.39e-11 66 24 11 349 3 mshA D-inositol 3-phosphate glycosyltransferase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0PVZ1 1.09e-10 66 24 7 267 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium ulcerans (strain Agy99)
C1AZ64 1.23e-10 66 26 5 193 3 mshA D-inositol 3-phosphate glycosyltransferase Rhodococcus opacus (strain B4)
C4LLD6 1.61e-10 65 24 4 203 3 mshA D-inositol 3-phosphate glycosyltransferase Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
A4X1R6 1.81e-10 65 23 14 351 3 mshA D-inositol 3-phosphate glycosyltransferase Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
A0LQY9 1.99e-10 65 22 7 290 3 mshA D-inositol 3-phosphate glycosyltransferase Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
A0QLK5 2.16e-10 65 25 7 276 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium avium (strain 104)
P54138 2.22e-10 65 25 8 278 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium leprae (strain TN)
B8ZT88 2.22e-10 65 25 8 278 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium leprae (strain Br4923)
C7QKE8 3.48e-10 64 26 6 205 3 mshA2 D-inositol 3-phosphate glycosyltransferase 2 Catenulispora acidiphila (strain DSM 44928 / JCM 14897 / NBRC 102108 / NRRL B-24433 / ID139908)
A0R043 3.69e-10 64 26 7 202 1 pimB GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
B1MHQ0 4.69e-10 64 22 9 314 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q1BEA6 4.9e-10 64 23 10 318 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium sp. (strain MCS)
A1UAM8 4.9e-10 64 23 10 318 3 mshA D-inositol 3-phosphate glycosyltransferase Mycobacterium sp. (strain KMS)
Q47KS6 4.98e-10 64 25 10 269 3 mshA D-inositol 3-phosphate glycosyltransferase Thermobifida fusca (strain YX)
A8LZG1 6.32e-10 63 22 15 401 3 mshA D-inositol 3-phosphate glycosyltransferase Salinispora arenicola (strain CNS-205)
D3Q051 7.08e-10 63 22 12 359 3 mshA D-inositol 3-phosphate glycosyltransferase Stackebrandtia nassauensis (strain DSM 44728 / CIP 108903 / NRRL B-16338 / NBRC 102104 / LLR-40K-21)
A8LDJ8 7.73e-10 63 23 10 279 3 mshA D-inositol 3-phosphate glycosyltransferase Parafrankia sp. (strain EAN1pec)
O05083 1.75e-09 62 27 3 155 3 HI_1698 Uncharacterized glycosyltransferase HI_1698 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
D6Y4U7 2.04e-09 62 27 6 205 3 mshA D-inositol 3-phosphate glycosyltransferase Thermobispora bispora (strain ATCC 19993 / DSM 43833 / CBS 139.67 / JCM 10125 / KCTC 9307 / NBRC 14880 / R51)
O34413 2.25e-09 62 25 13 284 3 ytcC Putative glycosyltransferase YtcC Bacillus subtilis (strain 168)
P71053 3.45e-09 61 24 2 199 2 epsD Putative glycosyltransferase EpsD Bacillus subtilis (strain 168)
D5USX8 1.04e-08 60 25 12 295 3 mshA D-inositol 3-phosphate glycosyltransferase Tsukamurella paurometabola (strain ATCC 8368 / DSM 20162 / CCUG 35730 / CIP 100753 / JCM 10117 / KCTC 9821 / NBRC 16120 / NCIMB 702349 / NCTC 13040)
Q8NNK8 1.21e-08 59 26 5 175 1 pimB GDP-mannose-dependent monoacylated alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
C0ZUT0 2.17e-08 59 27 5 192 3 mshA D-inositol 3-phosphate glycosyltransferase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
P54490 2.46e-08 58 21 13 347 3 yqgM Uncharacterized glycosyltransferase YqgM Bacillus subtilis (strain 168)
Q9R9N2 3.22e-08 58 26 4 175 3 lpsB Lipopolysaccharide core biosynthesis mannosyltransferase LpsB Rhizobium meliloti (strain 1021)
P39862 3.59e-08 58 24 8 244 3 capM Capsular polysaccharide biosynthesis glycosyltransferase CapM Staphylococcus aureus
Q58459 3.62e-08 58 22 5 208 3 MJ1059 Uncharacterized glycosyltransferase MJ1059 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
C7MSY6 4.22e-08 58 23 9 275 3 mshA D-inositol 3-phosphate glycosyltransferase Saccharomonospora viridis (strain ATCC 15386 / DSM 43017 / JCM 3036 / CCUG 5913 / NBRC 12207 / NCIMB 9602 / P101)
D2S4K7 4.79e-08 58 24 9 264 3 mshA D-inositol 3-phosphate glycosyltransferase Geodermatophilus obscurus (strain ATCC 25078 / DSM 43160 / JCM 3152 / CCUG 61914 / KCC A-0152 / KCTC 9177 / NBRC 13315 / NRRL B-3577 / G-20)
D7AW65 7.24e-08 57 22 11 346 3 mshA D-inositol 3-phosphate glycosyltransferase Nocardiopsis dassonvillei (strain ATCC 23218 / DSM 43111 / CIP 107115 / JCM 7437 / KCTC 9190 / NBRC 14626 / NCTC 10488 / NRRL B-5397 / IMRU 509)
C6WPK3 9.07e-08 57 22 12 357 3 mshA D-inositol 3-phosphate glycosyltransferase Actinosynnema mirum (strain ATCC 29888 / DSM 43827 / JCM 3225 / NBRC 14064 / NCIMB 13271 / NRRL B-12336 / IMRU 3971 / 101)
C8XA09 9.26e-08 57 24 11 298 3 mshA D-inositol 3-phosphate glycosyltransferase Nakamurella multipartita (strain ATCC 700099 / DSM 44233 / CIP 104796 / JCM 9543 / NBRC 105858 / Y-104)
Q04975 9.96e-08 57 22 1 179 4 vipC Vi polysaccharide biosynthesis protein VipC/TviE Salmonella typhi
Q58577 1.11e-07 56 21 13 345 3 MJ1178 Uncharacterized glycosyltransferase MJ1178 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q5YP47 1.19e-07 57 23 5 207 3 mshA D-inositol 3-phosphate glycosyltransferase Nocardia farcinica (strain IFM 10152)
B8HCF8 1.39e-07 56 23 4 186 3 mshA D-inositol 3-phosphate glycosyltransferase Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
A4T324 1.53e-07 56 23 11 318 3 mshA D-inositol 3-phosphate glycosyltransferase Mycolicibacterium gilvum (strain PYR-GCK)
A0R2E2 1.66e-07 56 23 14 398 1 glgM Alpha-maltose-1-phosphate synthase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
D1A4Q3 2.27e-07 56 25 5 201 3 mshA D-inositol 3-phosphate glycosyltransferase Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9)
C9ZH13 2.32e-07 56 22 12 350 3 mshA D-inositol 3-phosphate glycosyltransferase Streptomyces scabiei (strain 87.22)
P9WMZ1 2.33e-07 55 27 11 247 1 glgM Alpha-maltose-1-phosphate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMZ0 2.33e-07 55 27 11 247 3 glgM Alpha-maltose-1-phosphate synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q47594 2.34e-07 55 25 11 227 1 wbdB O-antigen chain mannosyltransferase B Escherichia coli
D2Q1C4 2.41e-07 55 25 7 214 3 mshA D-inositol 3-phosphate glycosyltransferase Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399)
Q65CC7 2.46e-07 55 26 7 194 1 kanE Alpha-D-kanosaminyltransferase Streptomyces kanamyceticus
D7C367 3.21e-07 55 22 13 345 3 mshA D-inositol 3-phosphate glycosyltransferase Streptomyces bingchenggensis (strain BCW-1)
A0JZ09 3.3e-07 55 26 10 261 3 mshA D-inositol 3-phosphate glycosyltransferase Arthrobacter sp. (strain FB24)
P9WMZ3 4.3e-07 55 27 8 203 1 pimB GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMZ2 4.3e-07 55 27 8 203 3 pimB GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A6M9B7 4.52e-07 54 23 3 188 1 wclY O-antigen biosynthesis glycosyltransferase WclY Escherichia coli
D0L476 5.69e-07 55 24 10 283 3 mshA D-inositol 3-phosphate glycosyltransferase Gordonia bronchialis (strain ATCC 25592 / DSM 43247 / BCRC 13721 / JCM 3198 / KCTC 3076 / NBRC 16047 / NCTC 10667)
P26402 8.31e-07 53 23 4 203 1 rfbU O-antigen chain mannosyltransferase RfbU Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
D6Z995 1.27e-06 53 23 4 191 3 mshA D-inositol 3-phosphate glycosyltransferase Segniliparus rotundus (strain ATCC BAA-972 / CDC 1076 / CIP 108378 / DSM 44985 / JCM 13578)
P27127 2.86e-06 52 26 8 207 1 waaB Lipopolysaccharide 1,6-galactosyltransferase Escherichia coli (strain K12)
D5UJ42 3.08e-06 52 24 10 254 3 mshA D-inositol 3-phosphate glycosyltransferase Cellulomonas flavigena (strain ATCC 482 / DSM 20109 / BCRC 11376 / JCM 18109 / NBRC 3775 / NCIMB 8073 / NRS 134)
Q42857 3.45e-06 52 27 6 201 2 WAXY Granule-bound starch synthase 1, chloroplastic/amyloplastic Ipomoea batatas
P49040 3.49e-06 52 24 11 259 1 SUS1 Sucrose synthase 1 Arabidopsis thaliana
Q48453 3.53e-06 52 25 7 197 4 None Uncharacterized 41.2 kDa protein in cps region Klebsiella pneumoniae
A6ZW78 3.69e-06 52 26 5 178 3 SPT14 Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit Saccharomyces cerevisiae (strain YJM789)
Q9L1I4 3.7e-06 52 29 2 107 3 SCO2592 Exopolysaccharide phosphotransferase SCO2592 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9LXL5 3.71e-06 52 25 12 239 1 SUS4 Sucrose synthase 4 Arabidopsis thaliana
Q82G92 4.18e-06 52 20 11 349 3 mshA D-inositol 3-phosphate glycosyltransferase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A0QWG6 6.42e-06 51 26 10 239 1 pimA Phosphatidyl-myo-inositol mannosyltransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
B8QSK0 6.99e-06 51 22 3 188 1 wclY O-antigen biosynthesis glycosyltransferase WclY Escherichia coli
D2B9F4 7.04e-06 51 21 9 273 3 mshA D-inositol 3-phosphate glycosyltransferase Streptosporangium roseum (strain ATCC 12428 / DSM 43021 / JCM 3005 / KCTC 9067 / NCIMB 10171 / NRRL 2505 / NI 9100)
Q0P9C7 1.26e-05 50 21 3 178 1 pglJ N-acetylgalactosamine-N,N'-diacetylbacillosaminyl-diphospho-undecaprenol 4-alpha-N-acetylgalactosaminyltransferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
D1BZ82 1.56e-05 50 21 7 272 3 mshA D-inositol 3-phosphate glycosyltransferase Xylanimonas cellulosilytica (strain DSM 15894 / JCM 12276 / CECT 5975 / KCTC 9989 / LMG 20990 / NBRC 107835 / XIL07)
Q8DPV9 1.59e-05 50 23 5 180 1 cpoA Alpha-galactosylglucosyldiacylglycerol synthase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q8S4F6 1.83e-05 50 23 4 190 1 SQD2 Sulfoquinovosyl transferase SQD2 Arabidopsis thaliana
A6W6D9 3.59e-05 49 22 4 176 3 mshA D-inositol 3-phosphate glycosyltransferase Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
Q06994 6.48e-05 48 26 12 234 1 waaB Lipopolysaccharide 1,6-galactosyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
D1BD84 7.23e-05 48 21 9 266 3 mshA D-inositol 3-phosphate glycosyltransferase Sanguibacter keddieii (strain ATCC 51767 / DSM 10542 / NCFB 3025 / ST-74)
Q4H4F8 8.25e-05 48 21 4 164 3 btrM 2-deoxystreptamine N-acetyl-D-glucosaminyltransferase Niallia circulans
P13708 9.2e-05 48 32 4 108 1 SS Sucrose synthase Glycine max
Q43784 0.000114 47 24 6 219 2 WAXY Granule-bound starch synthase 1, chloroplastic/amyloplastic Manihot esculenta
P87172 0.000126 47 22 5 210 3 gpi3 Phosphatidylinositol N-acetylglucosaminyltransferase gpi3 subunit Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q10LP5 0.000134 47 34 3 97 2 SUS4 Sucrose synthase 4 Oryza sativa subsp. japonica
Q53U18 0.000155 47 22 7 250 1 neoD 2-deoxystreptamine N-acetyl-D-glucosaminyltransferase Streptomyces fradiae
O68547 0.000164 47 26 5 227 3 lpcC Lipopolysaccharide core biosynthesis mannosyltransferase LpcC Rhizobium leguminosarum bv. viciae
B1VS68 0.000182 47 20 12 356 3 mshA D-inositol 3-phosphate glycosyltransferase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q01390 0.000218 47 32 3 99 1 SS1 Sucrose synthase Vigna radiata var. radiata
O82627 0.000254 46 23 5 197 2 WAXY Granule-bound starch synthase 1, chloroplastic/amyloplastic Antirrhinum majus
O65026 0.000278 46 31 4 109 2 None Sucrose synthase Medicago sativa
P49039 0.000304 46 22 6 193 3 None Sucrose synthase Solanum tuberosum
P31926 0.000323 46 26 9 184 2 SUCS Sucrose synthase Vicia faba
P49034 0.000331 46 24 8 183 2 SUS1 Sucrose synthase Alnus glutinosa
O24301 0.000347 46 32 3 98 2 SUS2 Sucrose synthase 2 Pisum sativum
A1R8N8 0.000391 45 20 4 200 3 mshA D-inositol 3-phosphate glycosyltransferase Paenarthrobacter aurescens (strain TC1)
P30298 0.000466 46 25 12 224 1 SUS2 Sucrose synthase 2 Oryza sativa subsp. japonica
P71055 0.000638 45 26 3 148 2 epsF Putative glycosyltransferase EpsF Bacillus subtilis (strain 168)
P26388 0.000703 45 22 6 220 3 wcaL Putative colanic acid biosynthesis glycosyltransferase WcaL Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q94BX4 0.000819 45 24 5 173 2 PIGA Phosphatidylinositol N-acetylglucosaminyltransferase subunit A Arabidopsis thaliana
P49037 0.001 45 22 6 194 2 None Sucrose synthase Solanum lycopersicum

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS17300
Feature type CDS
Gene -
Product glycosyltransferase family 4 protein
Location 92625 - 93758 (strand: -1)
Length 1134 (nucleotides) / 377 (amino acids)

Contig

Accession term accessions NZ_VXKB01000007 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 196482 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2165
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00534 Glycosyl transferases group 1
PF13439 Glycosyltransferase Family 4

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0438 Cell wall/membrane/envelope biogenesis (M) M Glycosyltransferase involved in cell wall bisynthesis

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02844 UDP-glucose:(heptosyl)LPS alpha-1,3-glucosyltransferase [EC:2.4.1.-] Lipopolysaccharide biosynthesis
Metabolic pathways		 -

Protein Sequence

MKDLRLAIVRQKYRPDGGAERFVSRALEALDTQNLELNVITRSWQGAAAPGWHIHVVNPVKWGRISRERGFANAARACWQAEKFDIVQSHERIAGCDIYRAGDGVHRRWLLQRARVLPGWRAKLLFASPYHRYVMKAEQAMYHDAHFKQVICNSEMVKKEVMEDFGLSESQITVIYNAIDSTKFYPATEEERLRLRREQGIPAQAKCLIYVGSGFERKGLAAAIKVVSRNNDTRLLVAGQDKDEKAYRQLASSLGCADRIHFLGMQKQTLPLYQMCDGLLLPTLYDPFPNVVLEAMACGLPVITSTTCGGAEFITQGEEGFVCDALDIDGLTDAVAQLPCNHLNNEMSEHARQRILPHTPAALSQQLISLYGRVLST

Flanking regions ( +/- flanking 50bp)

CTGGGTGCAATACCTGCGGACGTGGTGATTGCGGCAGCACGGAGTTACTTATGAAAGATCTGCGTTTAGCGATTGTCCGCCAGAAATACCGTCCTGACGGCGGCGCGGAACGGTTTGTTTCCCGCGCACTGGAAGCATTGGATACGCAAAACCTGGAGCTGAATGTGATCACCCGCTCCTGGCAGGGTGCTGCGGCTCCCGGCTGGCATATCCATGTGGTGAATCCGGTAAAATGGGGGCGTATCAGTCGTGAACGCGGGTTTGCCAATGCCGCCCGCGCCTGTTGGCAGGCAGAAAAATTTGATATTGTTCAGAGCCATGAGCGCATCGCCGGGTGTGATATTTATCGTGCGGGTGATGGTGTTCATCGCCGCTGGCTGTTACAGCGGGCGCGCGTTTTACCGGGCTGGCGGGCTAAATTATTGTTTGCTTCACCGTATCACCGTTATGTGATGAAAGCAGAGCAGGCGATGTATCATGATGCGCATTTTAAGCAGGTGATTTGTAACTCTGAGATGGTGAAAAAAGAAGTAATGGAAGACTTTGGTCTTTCTGAATCACAGATTACGGTTATCTATAATGCAATTGATTCAACCAAATTTTATCCGGCGACAGAAGAAGAACGTCTGCGGTTGCGCCGGGAACAAGGTATTCCGGCGCAGGCAAAATGCCTGATTTATGTCGGTTCCGGGTTTGAGCGAAAGGGACTGGCGGCAGCGATAAAAGTGGTCAGCCGTAATAATGATACCCGGTTGCTGGTCGCCGGGCAGGATAAAGATGAAAAAGCATACCGTCAGTTGGCGTCGTCACTGGGCTGCGCGGATCGTATCCATTTTCTCGGTATGCAGAAACAGACATTACCGCTCTATCAGATGTGTGACGGATTACTGCTCCCGACACTGTATGATCCGTTTCCGAATGTGGTTCTGGAAGCGATGGCCTGCGGATTGCCGGTGATCACCAGTACAACCTGCGGCGGCGCTGAATTTATTACCCAAGGCGAAGAGGGATTTGTCTGTGATGCCCTTGATATTGACGGATTGACTGATGCCGTTGCACAACTGCCCTGTAATCATCTGAATAATGAGATGTCTGAACATGCCCGGCAGCGGATTTTACCGCATACGCCGGCGGCACTGTCACAGCAACTGATCTCTCTCTACGGACGCGTACTGTCAACATGAAACAGCATATCTTATTTATTATTGACGGATTACCCGGCGGCGGTGCGGAG