Homologs in group_2085

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15595 FBDBKF_15595 100.0 Morganella morganii S1 rnpA ribonuclease P protein component
EHELCC_15955 EHELCC_15955 100.0 Morganella morganii S2 rnpA ribonuclease P protein component
NLDBIP_16415 NLDBIP_16415 100.0 Morganella morganii S4 rnpA ribonuclease P protein component
LHKJJB_16390 LHKJJB_16390 100.0 Morganella morganii S3 rnpA ribonuclease P protein component
F4V73_RS17565 F4V73_RS17565 94.4 Morganella psychrotolerans rnpA ribonuclease P protein component
PMI_RS15490 PMI_RS15490 80.6 Proteus mirabilis HI4320 rnpA ribonuclease P protein component

Distribution of the homologs in the orthogroup group_2085

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2085

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P22835 2.59e-62 188 80 0 108 3 rnpA Ribonuclease P protein component Proteus mirabilis
B4F0U3 2.59e-62 188 80 0 108 3 rnpA Ribonuclease P protein component Proteus mirabilis (strain HI4320)
Q7M7H7 1.23e-60 184 81 0 108 3 rnpA Ribonuclease P protein component Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JT84 9.08e-57 174 77 0 108 3 rnpA Ribonuclease P protein component Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q6CYR1 1.47e-56 173 79 0 105 3 rnpA Ribonuclease P protein component Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q663S9 3.95e-56 172 76 0 108 3 rnpA Ribonuclease P protein component Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TSL3 3.95e-56 172 76 0 108 3 rnpA Ribonuclease P protein component Yersinia pestis (strain Pestoides F)
Q1CCJ6 3.95e-56 172 76 0 108 3 rnpA Ribonuclease P protein component Yersinia pestis bv. Antiqua (strain Nepal516)
Q8Z9U4 3.95e-56 172 76 0 108 3 rnpA Ribonuclease P protein component Yersinia pestis
Q1C0B6 3.95e-56 172 76 0 108 3 rnpA Ribonuclease P protein component Yersinia pestis bv. Antiqua (strain Antiqua)
A7FPB9 3.95e-56 172 76 0 108 3 rnpA Ribonuclease P protein component Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B5BIL6 2.47e-54 168 73 0 108 3 rnpA Ribonuclease P protein component Salmonella paratyphi A (strain AKU_12601)
A8ACL6 3.07e-54 167 73 0 108 3 rnpA Ribonuclease P protein component Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5XZP6 3.28e-54 167 73 0 108 3 rnpA Ribonuclease P protein component Klebsiella pneumoniae (strain 342)
P66686 3.58e-54 167 73 0 108 3 rnpA Ribonuclease P protein component Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66687 3.58e-54 167 73 0 108 3 rnpA Ribonuclease P protein component Salmonella typhi
B4TN09 3.58e-54 167 73 0 108 3 rnpA Ribonuclease P protein component Salmonella schwarzengrund (strain CVM19633)
Q5PKU4 3.58e-54 167 73 0 108 3 rnpA Ribonuclease P protein component Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SYB0 3.58e-54 167 73 0 108 3 rnpA Ribonuclease P protein component Salmonella newport (strain SL254)
B4TAV1 3.58e-54 167 73 0 108 3 rnpA Ribonuclease P protein component Salmonella heidelberg (strain SL476)
B5RFY5 3.58e-54 167 73 0 108 3 rnpA Ribonuclease P protein component Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QUQ2 3.58e-54 167 73 0 108 3 rnpA Ribonuclease P protein component Salmonella enteritidis PT4 (strain P125109)
B5FN12 3.58e-54 167 73 0 108 3 rnpA Ribonuclease P protein component Salmonella dublin (strain CT_02021853)
B5EYX4 3.58e-54 167 73 0 108 3 rnpA Ribonuclease P protein component Salmonella agona (strain SL483)
A7MN01 6.4e-54 167 72 0 108 3 rnpA Ribonuclease P protein component Cronobacter sakazakii (strain ATCC BAA-894)
A8G7Q0 1.2e-53 166 73 0 108 3 rnpA Ribonuclease P protein component Serratia proteamaculans (strain 568)
Q3YWB0 1.81e-53 166 72 0 108 3 rnpA Ribonuclease P protein component Shigella sonnei (strain Ss046)
P0A7Y9 1.81e-53 166 72 0 108 3 rnpA Ribonuclease P protein component Shigella flexneri
Q329B4 1.81e-53 166 72 0 108 3 rnpA Ribonuclease P protein component Shigella dysenteriae serotype 1 (strain Sd197)
Q31UV7 1.81e-53 166 72 0 108 3 rnpA Ribonuclease P protein component Shigella boydii serotype 4 (strain Sb227)
B2TUS4 1.81e-53 166 72 0 108 3 rnpA Ribonuclease P protein component Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LK46 1.81e-53 166 72 0 108 3 rnpA Ribonuclease P protein component Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R4N2 1.81e-53 166 72 0 108 3 rnpA Ribonuclease P protein component Escherichia coli (strain UTI89 / UPEC)
B1LL31 1.81e-53 166 72 0 108 3 rnpA Ribonuclease P protein component Escherichia coli (strain SMS-3-5 / SECEC)
B6I3T7 1.81e-53 166 72 0 108 3 rnpA Ribonuclease P protein component Escherichia coli (strain SE11)
B7NF21 1.81e-53 166 72 0 108 3 rnpA Ribonuclease P protein component Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7Y8 1.81e-53 166 72 0 108 1 rnpA Ribonuclease P protein component Escherichia coli (strain K12)
A1AHN8 1.81e-53 166 72 0 108 3 rnpA Ribonuclease P protein component Escherichia coli O1:K1 / APEC
A8A6G5 1.81e-53 166 72 0 108 3 rnpA Ribonuclease P protein component Escherichia coli O9:H4 (strain HS)
B1X9T2 1.81e-53 166 72 0 108 3 rnpA Ribonuclease P protein component Escherichia coli (strain K12 / DH10B)
C4ZYY1 1.81e-53 166 72 0 108 3 rnpA Ribonuclease P protein component Escherichia coli (strain K12 / MC4100 / BW2952)
B7M556 1.81e-53 166 72 0 108 3 rnpA Ribonuclease P protein component Escherichia coli O8 (strain IAI1)
B7N2E9 1.81e-53 166 72 0 108 3 rnpA Ribonuclease P protein component Escherichia coli O81 (strain ED1a)
B7NR06 1.81e-53 166 72 0 108 3 rnpA Ribonuclease P protein component Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7L844 1.81e-53 166 72 0 108 3 rnpA Ribonuclease P protein component Escherichia coli (strain 55989 / EAEC)
B7MGC5 1.81e-53 166 72 0 108 3 rnpA Ribonuclease P protein component Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UMH1 1.81e-53 166 72 0 108 3 rnpA Ribonuclease P protein component Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZTR0 1.81e-53 166 72 0 108 3 rnpA Ribonuclease P protein component Escherichia coli O139:H28 (strain E24377A / ETEC)
A9MJT8 3.28e-53 165 72 0 108 3 rnpA Ribonuclease P protein component Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
C5BF62 3.35e-53 165 73 0 108 3 rnpA Ribonuclease P protein component Edwardsiella ictaluri (strain 93-146)
B2VCE5 4.04e-53 165 73 0 108 3 rnpA Ribonuclease P protein component Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B5YXA8 4.46e-53 164 72 0 108 3 rnpA Ribonuclease P protein component Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XB43 4.46e-53 164 72 0 108 3 rnpA Ribonuclease P protein component Escherichia coli O157:H7
Q8FBV5 1.04e-52 164 73 0 105 3 rnpA Ribonuclease P protein component Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q2NQ69 3.21e-50 157 67 0 108 3 rnpA Ribonuclease P protein component Sodalis glossinidius (strain morsitans)
Q65VC0 1.17e-45 146 62 0 108 3 rnpA Ribonuclease P protein component Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P57915 1.42e-45 145 61 0 108 3 rnpA Ribonuclease P protein component Pasteurella multocida (strain Pm70)
P44306 2.67e-43 140 62 0 108 3 rnpA Ribonuclease P protein component Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UID3 2.79e-43 140 62 0 108 3 rnpA Ribonuclease P protein component Haemophilus influenzae (strain PittGG)
Q4QLR2 2.79e-43 140 62 0 108 3 rnpA Ribonuclease P protein component Haemophilus influenzae (strain 86-028NP)
B0URU5 3.82e-42 137 56 0 108 3 rnpA Ribonuclease P protein component Histophilus somni (strain 2336)
Q0I0Y9 3.82e-42 137 56 0 108 3 rnpA Ribonuclease P protein component Histophilus somni (strain 129Pt)
C4K7P7 3.84e-40 132 60 0 102 3 rnpA Ribonuclease P protein component Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A1S1G7 1.04e-38 128 59 0 103 3 rnpA Ribonuclease P protein component Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q7VN34 4.67e-37 124 52 0 108 3 rnpA Ribonuclease P protein component Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q07VS4 9.98e-37 123 57 0 103 3 rnpA Ribonuclease P protein component Shewanella frigidimarina (strain NCIMB 400)
B1KQ67 1.74e-36 122 58 0 103 3 rnpA Ribonuclease P protein component Shewanella woodyi (strain ATCC 51908 / MS32)
Q3IK52 2.25e-36 123 55 0 100 3 rnpA Ribonuclease P protein component Pseudoalteromonas translucida (strain TAC 125)
A1RQF1 7.81e-36 121 56 0 103 3 rnpA Ribonuclease P protein component Shewanella sp. (strain W3-18-1)
A4YCM4 7.81e-36 121 56 0 103 3 rnpA Ribonuclease P protein component Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q0HPE4 1.12e-35 120 56 0 103 3 rnpA Ribonuclease P protein component Shewanella sp. (strain MR-7)
Q0HD62 1.12e-35 120 56 0 103 3 rnpA Ribonuclease P protein component Shewanella sp. (strain MR-4)
A0KR34 1.12e-35 120 56 0 103 3 rnpA Ribonuclease P protein component Shewanella sp. (strain ANA-3)
A9KX22 2.49e-35 120 56 0 103 3 rnpA Ribonuclease P protein component Shewanella baltica (strain OS195)
A6WUK6 2.49e-35 120 56 0 103 3 rnpA Ribonuclease P protein component Shewanella baltica (strain OS185)
A3DAT0 2.49e-35 120 56 0 103 3 rnpA Ribonuclease P protein component Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EDW7 2.49e-35 120 56 0 103 3 rnpA Ribonuclease P protein component Shewanella baltica (strain OS223)
Q12HM6 7.43e-35 119 55 0 103 3 rnpA Ribonuclease P protein component Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q8EKT4 7.6e-35 119 55 0 103 3 rnpA Ribonuclease P protein component Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q6LW54 1.08e-34 118 54 0 105 3 rnpA Ribonuclease P protein component Photobacterium profundum (strain SS9)
Q1LTW1 1.11e-34 118 49 0 104 3 rnpA Ribonuclease P protein component Baumannia cicadellinicola subsp. Homalodisca coagulata
A0KQZ9 3e-34 117 55 0 103 3 rnpA Ribonuclease P protein component Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4STS7 3.66e-34 117 55 0 103 3 rnpA Ribonuclease P protein component Aeromonas salmonicida (strain A449)
Q87TR4 5.21e-34 116 53 0 103 3 rnpA Ribonuclease P protein component Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q15MS5 6.87e-34 116 49 0 108 3 rnpA Ribonuclease P protein component Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
C3LP79 1.26e-33 115 51 0 103 3 rnpA Ribonuclease P protein component Vibrio cholerae serotype O1 (strain M66-2)
Q9KVY2 1.26e-33 115 51 0 103 3 rnpA Ribonuclease P protein component Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F483 1.26e-33 115 51 0 103 3 rnpA Ribonuclease P protein component Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A7N1E4 2.36e-33 115 52 0 103 3 rnpA Ribonuclease P protein component Vibrio campbellii (strain ATCC BAA-1116)
A1T0M7 4.74e-33 114 51 0 100 3 rnpA Ribonuclease P protein component Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q7MQK4 8.02e-33 113 52 0 103 3 rnpA Ribonuclease P protein component Vibrio vulnificus (strain YJ016)
Q8DDI3 8.02e-33 113 52 0 103 3 rnpA Ribonuclease P protein component Vibrio vulnificus (strain CMCP6)
Q5E8Z7 2.68e-32 112 51 0 103 3 rnpA Ribonuclease P protein component Aliivibrio fischeri (strain ATCC 700601 / ES114)
B6EP41 5.41e-31 108 50 0 103 3 rnpA Ribonuclease P protein component Aliivibrio salmonicida (strain LFI1238)
Q5QZK1 5.93e-29 103 49 1 101 3 rnpA Ribonuclease P protein component Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q3K426 1.28e-28 103 48 1 104 3 rnpA Ribonuclease P protein component Pseudomonas fluorescens (strain Pf0-1)
A4Y1A2 1.29e-28 103 49 1 104 3 rnpA Ribonuclease P protein component Pseudomonas mendocina (strain ymp)
P29433 7.11e-28 100 45 0 98 3 rnpA Ribonuclease P protein component Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q48BF0 1.04e-27 101 47 1 104 3 rnpA Ribonuclease P protein component Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B0KEU7 1.12e-27 101 46 1 104 3 rnpA Ribonuclease P protein component Pseudomonas putida (strain GB-1)
Q87TR9 1.77e-27 100 47 1 104 3 rnpA Ribonuclease P protein component Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
C1DNF9 2.85e-27 100 48 2 105 3 rnpA Ribonuclease P protein component Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A5WBB9 3.62e-27 99 46 1 104 3 rnpA Ribonuclease P protein component Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P0A168 3.84e-27 99 46 1 104 3 rnpA Ribonuclease P protein component Pseudomonas putida
P0A167 3.84e-27 99 46 1 104 3 rnpA Ribonuclease P protein component Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A4VS84 7.55e-27 99 48 1 104 3 rnpA Ribonuclease P protein component Stutzerimonas stutzeri (strain A1501)
Q1I2H2 8.71e-27 99 46 1 104 3 rnpA Ribonuclease P protein component Pseudomonas entomophila (strain L48)
P59413 9.56e-27 98 43 0 101 3 rnpA Ribonuclease P protein component Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q7VQV1 2.95e-26 97 48 1 99 3 rnpA Ribonuclease P protein component Blochmanniella floridana
Q494B8 1.7e-25 95 50 1 102 3 rnpA Ribonuclease P protein component Blochmanniella pennsylvanica (strain BPEN)
A6VF46 4.34e-25 94 47 1 101 3 rnpA Ribonuclease P protein component Pseudomonas aeruginosa (strain PA7)
P57130 7.08e-25 93 48 0 89 3 rnpA Ribonuclease P protein component Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q9HT05 7.32e-25 94 47 1 101 3 rnpA Ribonuclease P protein component Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02DD9 7.32e-25 94 47 1 101 3 rnpA Ribonuclease P protein component Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V7A6 8.25e-25 94 47 1 101 3 rnpA Ribonuclease P protein component Pseudomonas aeruginosa (strain LESB58)
Q21DF8 3.49e-22 87 44 1 101 3 rnpA Ribonuclease P protein component Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q602M8 1.33e-21 85 40 0 98 3 rnpA Ribonuclease P protein component Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q1QS97 1.82e-20 82 41 1 101 3 rnpA Ribonuclease P protein component Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A5IIK5 4.57e-20 81 39 1 100 3 rnpA Ribonuclease P protein component Legionella pneumophila (strain Corby)
Q5X0M0 4.57e-20 81 39 1 100 3 rnpA Ribonuclease P protein component Legionella pneumophila (strain Paris)
Q5WSE7 6.06e-20 80 39 1 100 3 rnpA Ribonuclease P protein component Legionella pneumophila (strain Lens)
B0VQP7 2.19e-19 80 45 1 87 3 rnpA Ribonuclease P protein component Acinetobacter baumannii (strain SDF)
B0V5R2 2.29e-19 79 45 1 87 3 rnpA Ribonuclease P protein component Acinetobacter baumannii (strain AYE)
Q6F6K8 1.16e-18 78 45 0 86 3 rnpA Ribonuclease P protein component Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B8GRD3 1.39e-17 75 39 0 99 3 rnpA Ribonuclease P protein component Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q3J6L7 7.26e-17 73 36 0 98 3 rnpA Ribonuclease P protein component Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A1WWE2 9.44e-16 70 39 1 99 3 rnpA Ribonuclease P protein component Halorhodospira halophila (strain DSM 244 / SL1)
A1U7J6 1.08e-15 70 39 3 105 3 rnpA Ribonuclease P protein component Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q0VKU6 1.16e-15 70 39 1 99 3 rnpA Ribonuclease P protein component Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q7NPT6 2.01e-15 69 36 0 108 3 rnpA Ribonuclease P protein component Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A6W3V2 2.87e-15 69 37 1 106 3 rnpA Ribonuclease P protein component Marinomonas sp. (strain MWYL1)
Q9JW46 4.93e-15 68 46 0 69 3 rnpA Ribonuclease P protein component Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
B4RJJ5 5.61e-15 68 46 0 69 3 rnpA Ribonuclease P protein component Neisseria gonorrhoeae (strain NCCP11945)
Q5F4W3 5.61e-15 68 46 0 69 3 rnpA Ribonuclease P protein component Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A1KS00 9.61e-14 65 44 0 69 3 rnpA Ribonuclease P protein component Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JXS6 2.33e-13 64 44 0 69 3 rnpA Ribonuclease P protein component Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
C4KZZ5 8.23e-13 62 34 2 105 3 rnpA Ribonuclease P protein component Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
C0QIZ3 1.23e-12 62 41 3 81 3 rnpA Ribonuclease P protein component Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
Q2LSG2 8.86e-12 60 34 2 89 3 rnpA Ribonuclease P protein component Syntrophus aciditrophicus (strain SB)
P45648 1.25e-10 57 33 0 96 3 rnpA Ribonuclease P protein component Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NBA3 1.25e-10 57 33 0 96 3 rnpA Ribonuclease P protein component Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KBT3 1.3e-10 57 33 0 96 3 rnpA Ribonuclease P protein component Coxiella burnetii (strain Dugway 5J108-111)
Q8P337 2.12e-10 57 35 1 99 3 rnpA Ribonuclease P protein component Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RMM7 2.12e-10 57 35 1 99 3 rnpA Ribonuclease P protein component Xanthomonas campestris pv. campestris (strain B100)
Q4UNK7 2.12e-10 57 35 1 99 3 rnpA Ribonuclease P protein component Xanthomonas campestris pv. campestris (strain 8004)
A5WI39 2.54e-10 56 30 2 113 3 rnpA Ribonuclease P protein component Psychrobacter sp. (strain PRwf-1)
Q3BLZ6 3.35e-10 56 34 1 99 3 rnpA Ribonuclease P protein component Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q2NX51 5.01e-10 56 34 1 99 3 rnpA Ribonuclease P protein component Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q6APZ0 2.15e-09 53 36 2 92 3 rnpA Ribonuclease P protein component Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A8AUN9 2.4e-09 53 35 1 87 3 rnpA Ribonuclease P protein component Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
B9E8Z6 2.62e-09 53 31 2 91 3 rnpA Ribonuclease P protein component Macrococcus caseolyticus (strain JCSC5402)
Q8PEH6 6.05e-09 53 33 1 95 3 rnpA Ribonuclease P protein component Xanthomonas axonopodis pv. citri (strain 306)
Q879S2 1.1e-08 52 35 2 111 3 rnpA Ribonuclease P protein component Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B1YGB0 1.48e-08 51 30 3 98 3 rnpA Ribonuclease P protein component Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A5CVI0 1.76e-08 51 32 0 77 3 rnpA Ribonuclease P protein component Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A1KCQ1 3.1e-08 50 38 1 92 3 rnpA Ribonuclease P protein component Azoarcus sp. (strain BH72)
A8ZRZ3 3.6e-08 50 39 2 78 3 rnpA Ribonuclease P protein component Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q82X99 4.61e-08 50 39 0 74 3 rnpA Ribonuclease P protein component Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A8FJG3 5.02e-08 50 33 4 104 3 rnpA Ribonuclease P protein component Bacillus pumilus (strain SAFR-032)
Q9P9U0 5.57e-08 50 41 0 73 3 rnpA Ribonuclease P protein component Xylella fastidiosa (strain 9a5c)
Q8RHA6 6.71e-08 50 35 3 77 3 rnpA Ribonuclease P protein component Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
B5YBN8 1.03e-07 49 34 3 103 3 rnpA Ribonuclease P protein component Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
A6TXE9 1.07e-07 49 31 2 97 3 rnpA Ribonuclease P protein component Alkaliphilus metalliredigens (strain QYMF)
Q0AE58 1.4e-07 49 52 0 50 3 rnpA Ribonuclease P protein component Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q8CMN4 1.63e-07 48 28 2 89 3 rnpA Ribonuclease P protein component Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HS37 1.63e-07 48 28 2 89 3 rnpA Ribonuclease P protein component Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A0LLH1 2.09e-07 48 35 2 92 3 rnpA Ribonuclease P protein component Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
B2A474 2.27e-07 48 39 2 82 3 rnpA Ribonuclease P protein component Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
P25814 3.12e-07 48 33 3 100 1 rnpA Ribonuclease P protein component Bacillus subtilis (strain 168)
Q8E6W5 3.96e-07 47 30 1 92 3 rnpA Ribonuclease P protein component Streptococcus agalactiae serotype III (strain NEM316)
Q8E1E7 4.45e-07 47 30 1 92 3 rnpA Ribonuclease P protein component Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q3K2X6 4.45e-07 47 30 1 92 3 rnpA Ribonuclease P protein component Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
B8FMU9 5.45e-07 47 42 2 69 3 rnpA Ribonuclease P protein component Desulfatibacillum aliphaticivorans
A9KLY3 5.84e-07 47 30 2 100 3 rnpA Ribonuclease P protein component Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q4L2Z1 6.81e-07 47 26 1 88 3 rnpA Ribonuclease P protein component Staphylococcus haemolyticus (strain JCSC1435)
B8DYS1 8.39e-07 47 33 3 103 3 rnpA Ribonuclease P protein component Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
Q181T2 1.01e-06 47 26 2 99 3 rnpA Ribonuclease P protein component Clostridioides difficile (strain 630)
C0ZA70 1.46e-06 46 29 3 105 3 rnpA Ribonuclease P protein component Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
A7ZAW4 1.6e-06 46 31 3 109 3 rnpA Ribonuclease P protein component Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A4ITX4 1.75e-06 46 32 3 102 3 rnpA Ribonuclease P protein component Geobacillus thermodenitrificans (strain NG80-2)
A2RCF8 2.93e-06 45 29 1 88 3 rnpA Ribonuclease P protein component Streptococcus pyogenes serotype M5 (strain Manfredo)
Q5KU54 3.03e-06 45 32 3 102 3 rnpA Ribonuclease P protein component Geobacillus kaustophilus (strain HTA426)
B8J2U6 3.17e-06 45 41 3 72 3 rnpA Ribonuclease P protein component Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
B1LBK1 3.38e-06 45 32 2 76 3 rnpA Ribonuclease P protein component Thermotoga sp. (strain RQ2)
Q9X1H4 3.53e-06 45 32 2 76 1 rnpA Ribonuclease P protein component Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B5XJN7 4.76e-06 45 29 1 88 3 rnpA Ribonuclease P protein component Streptococcus pyogenes serotype M49 (strain NZ131)
P0DF25 4.76e-06 45 29 1 88 3 rnpA Ribonuclease P protein component Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48VE1 4.76e-06 45 29 1 88 3 rnpA Ribonuclease P protein component Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1J8K9 4.76e-06 45 29 1 88 3 rnpA Ribonuclease P protein component Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JIQ1 4.76e-06 45 29 1 88 3 rnpA Ribonuclease P protein component Streptococcus pyogenes serotype M2 (strain MGAS10270)
P66691 4.76e-06 45 29 1 88 3 rnpA Ribonuclease P protein component Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XDZ0 4.76e-06 45 29 1 88 3 rnpA Ribonuclease P protein component Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DF24 4.76e-06 45 29 1 88 3 rnpA Ribonuclease P protein component Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q9A1J4 4.76e-06 45 29 1 88 3 rnpA Ribonuclease P protein component Streptococcus pyogenes serotype M1
Q03IQ0 5.43e-06 45 31 1 90 3 rnpA Ribonuclease P protein component Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
A5G9V6 6.33e-06 44 31 1 86 3 rnpA Ribonuclease P protein component Geotalea uraniireducens (strain Rf4)
Q9RCA4 7.98e-06 44 35 3 65 3 rnpA Ribonuclease P protein component Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9CJ73 8.3e-06 44 34 1 88 3 rnpA Ribonuclease P protein component Lactococcus lactis subsp. lactis (strain IL1403)
B8HR50 8.37e-06 44 38 1 70 3 rnpA Ribonuclease P protein component Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q9PPN6 9.67e-06 44 28 0 69 3 rnpA Ribonuclease P protein component Ureaplasma parvum serovar 3 (strain ATCC 700970)
B1AJP4 9.67e-06 44 28 0 69 3 rnpA Ribonuclease P protein component Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736)
A5IMC2 1.06e-05 44 31 2 76 3 rnpA Ribonuclease P protein component Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
B9IT45 1.21e-05 44 31 4 99 3 rnpA Ribonuclease P protein component Bacillus cereus (strain Q1)
Q13SH2 1.22e-05 44 38 3 77 3 rnpA Ribonuclease P protein component Paraburkholderia xenovorans (strain LB400)
A3N475 1.23e-05 44 37 3 77 3 rnpA Ribonuclease P protein component Burkholderia pseudomallei (strain 668)
A1V7D7 1.23e-05 44 37 3 77 3 rnpA Ribonuclease P protein component Burkholderia mallei (strain SAVP1)
Q62EM2 1.23e-05 44 37 3 77 3 rnpA Ribonuclease P protein component Burkholderia mallei (strain ATCC 23344)
A2S8D4 1.23e-05 44 37 3 77 3 rnpA Ribonuclease P protein component Burkholderia mallei (strain NCTC 10229)
A3MS22 1.23e-05 44 37 3 77 3 rnpA Ribonuclease P protein component Burkholderia mallei (strain NCTC 10247)
Q63YW3 1.26e-05 44 37 3 77 3 rnpA Ribonuclease P protein component Burkholderia pseudomallei (strain K96243)
A3NPW9 1.26e-05 44 37 3 77 3 rnpA Ribonuclease P protein component Burkholderia pseudomallei (strain 1106a)
C5D9Z1 1.27e-05 43 35 2 78 3 rnpA Ribonuclease P protein component Geobacillus sp. (strain WCH70)
C1ER80 1.45e-05 43 30 4 99 3 rnpA Ribonuclease P protein component Bacillus cereus (strain 03BB102)
B7IST7 1.59e-05 43 31 4 99 3 rnpA Ribonuclease P protein component Bacillus cereus (strain G9842)
C1CTU8 1.69e-05 43 31 2 92 3 rnpA Ribonuclease P protein component Streptococcus pneumoniae (strain Taiwan19F-14)
C1CMY8 1.69e-05 43 31 2 92 3 rnpA Ribonuclease P protein component Streptococcus pneumoniae (strain P1031)
C1CGX2 1.69e-05 43 31 2 92 3 rnpA Ribonuclease P protein component Streptococcus pneumoniae (strain JJA)
Q8DN92 1.69e-05 43 31 2 92 3 rnpA Ribonuclease P protein component Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IML6 1.69e-05 43 31 2 92 3 rnpA Ribonuclease P protein component Streptococcus pneumoniae (strain CGSP14)
B8ZPA3 1.69e-05 43 31 2 92 3 rnpA Ribonuclease P protein component Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
C1CA87 1.69e-05 43 31 2 92 3 rnpA Ribonuclease P protein component Streptococcus pneumoniae (strain 70585)
B5E2W2 1.69e-05 43 31 2 92 3 rnpA Ribonuclease P protein component Streptococcus pneumoniae serotype 19F (strain G54)
Q04ID0 1.69e-05 43 31 2 92 3 rnpA Ribonuclease P protein component Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q5WAG0 1.74e-05 43 38 2 72 3 rnpA Ribonuclease P protein component Shouchella clausii (strain KSM-K16)
B1I998 1.75e-05 43 32 2 89 3 rnpA Ribonuclease P protein component Streptococcus pneumoniae (strain Hungary19A-6)
Q2YZB7 1.85e-05 43 25 2 89 3 rnpA Ribonuclease P protein component Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6G5W3 1.91e-05 43 25 2 89 3 rnpA Ribonuclease P protein component Staphylococcus aureus (strain MSSA476)
Q6GD91 1.91e-05 43 25 2 89 3 rnpA Ribonuclease P protein component Staphylococcus aureus (strain MRSA252)
P66689 1.91e-05 43 25 2 89 3 rnpA Ribonuclease P protein component Staphylococcus aureus (strain N315)
P66688 1.91e-05 43 25 2 89 3 rnpA Ribonuclease P protein component Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HCI2 1.91e-05 43 25 2 89 3 rnpA Ribonuclease P protein component Staphylococcus aureus (strain COL)
A7X7A9 1.91e-05 43 25 2 89 3 rnpA Ribonuclease P protein component Staphylococcus aureus (strain Mu3 / ATCC 700698)
P0A0H4 1.99e-05 43 25 2 89 3 rnpA Ribonuclease P protein component Staphylococcus aureus (strain MW2)
P0A0H5 1.99e-05 43 25 2 89 1 rnpA Ribonuclease P protein component Staphylococcus aureus
A8YYS2 1.99e-05 43 25 2 89 3 rnpA Ribonuclease P protein component Staphylococcus aureus (strain USA300 / TCH1516)
A5IWD8 1.99e-05 43 25 2 89 3 rnpA Ribonuclease P protein component Staphylococcus aureus (strain JH9)
Q2FUQ1 1.99e-05 43 25 2 89 1 rnpA Ribonuclease P protein component Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FDE7 1.99e-05 43 25 2 89 3 rnpA Ribonuclease P protein component Staphylococcus aureus (strain USA300)
A6U596 1.99e-05 43 25 2 89 3 rnpA Ribonuclease P protein component Staphylococcus aureus (strain JH1)
B7HZH3 2.1e-05 43 31 4 99 3 rnpA Ribonuclease P protein component Bacillus cereus (strain AH187)
Q1JNK3 2.17e-05 43 27 1 92 3 rnpA Ribonuclease P protein component Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JDN4 2.17e-05 43 27 1 92 3 rnpA Ribonuclease P protein component Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q032X2 2.21e-05 43 45 1 62 3 rnpA Ribonuclease P protein component Lactococcus lactis subsp. cremoris (strain SK11)
A2RHL3 2.21e-05 43 45 1 62 3 rnpA Ribonuclease P protein component Lactococcus lactis subsp. cremoris (strain MG1363)
Q9Z6X2 2.29e-05 43 47 2 48 3 rnpA Ribonuclease P protein component Chlamydia pneumoniae
Q5M2K4 2.66e-05 43 31 1 88 3 rnpA Ribonuclease P protein component Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LY00 2.66e-05 43 31 1 88 3 rnpA Ribonuclease P protein component Streptococcus thermophilus (strain CNRZ 1066)
B4SPG1 2.99e-05 43 33 3 92 3 rnpA Ribonuclease P protein component Stenotrophomonas maltophilia (strain R551-3)
Q7MXI4 3.44e-05 43 43 0 48 3 rnpA Ribonuclease P protein component Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B1KUB6 3.65e-05 42 30 3 100 3 rnpA Ribonuclease P protein component Clostridium botulinum (strain Loch Maree / Type A3)
Q72WU0 3.99e-05 42 31 4 99 3 rnpA Ribonuclease P protein component Bacillus cereus (strain ATCC 10987 / NRS 248)
Q5P4P2 4.04e-05 42 36 1 75 3 rnpA Ribonuclease P protein component Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q6HAE9 4.26e-05 42 31 4 99 3 rnpA Ribonuclease P protein component Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q630B5 4.26e-05 42 31 4 99 3 rnpA Ribonuclease P protein component Bacillus cereus (strain ZK / E33L)
B7JIL4 4.26e-05 42 31 4 99 3 rnpA Ribonuclease P protein component Bacillus cereus (strain AH820)
Q81JH0 4.26e-05 42 31 4 99 3 rnpA Ribonuclease P protein component Bacillus anthracis
C3LGU4 4.26e-05 42 31 4 99 3 rnpA Ribonuclease P protein component Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P3F8 4.26e-05 42 31 4 99 3 rnpA Ribonuclease P protein component Bacillus anthracis (strain A0248)
B0S3V6 4.66e-05 42 31 3 97 3 rnpA Ribonuclease P protein component Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
B5EGY0 4.95e-05 42 31 2 88 3 rnpA Ribonuclease P protein component Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
A7GJP3 5.74e-05 42 29 2 98 3 rnpA Ribonuclease P protein component Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IHS3 5.74e-05 42 29 2 98 3 rnpA Ribonuclease P protein component Clostridium botulinum (strain Okra / Type B1)
C1FP35 5.74e-05 42 29 2 98 3 rnpA Ribonuclease P protein component Clostridium botulinum (strain Kyoto / Type A2)
A5I820 5.74e-05 42 29 2 98 3 rnpA Ribonuclease P protein component Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FPL5 5.74e-05 42 29 2 98 3 rnpA Ribonuclease P protein component Clostridium botulinum (strain ATCC 19397 / Type A)
A7GVQ0 6.33e-05 42 29 3 100 3 rnpA Ribonuclease P protein component Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B2RHI3 7.59e-05 42 43 0 48 3 rnpA Ribonuclease P protein component Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
A5N455 8.44e-05 42 30 2 97 3 rnpA Ribonuclease P protein component Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
Q82YV0 0.000116 41 31 3 87 3 rnpA Ribonuclease P protein component Enterococcus faecalis (strain ATCC 700802 / V583)
Q255T8 0.000117 42 46 1 43 3 rnpA Ribonuclease P protein component Chlamydia felis (strain Fe/C-56)
Q5L548 0.000118 42 44 1 43 3 rnpA Ribonuclease P protein component Chlamydia abortus (strain DSM 27085 / S26/3)
Q2KTI7 0.00012 41 42 0 52 3 rnpA Ribonuclease P protein component Bordetella avium (strain 197N)
Q30YQ3 0.000251 40 41 3 62 3 rnpA Ribonuclease P protein component Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A8MKS3 0.000271 40 25 2 104 3 rnpA Ribonuclease P protein component Alkaliphilus oremlandii (strain OhILAs)
Q8Y3I1 0.000272 40 31 4 96 3 rnpA Ribonuclease P protein component Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71VQ7 0.000272 40 31 4 96 3 rnpA Ribonuclease P protein component Listeria monocytogenes serotype 4b (strain F2365)
C1L0I8 0.000272 40 31 4 96 3 rnpA Ribonuclease P protein component Listeria monocytogenes serotype 4b (strain CLIP80459)
Q821V0 0.000273 40 44 1 43 3 rnpA Ribonuclease P protein component Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
A9IJC1 0.000274 40 45 0 42 3 rnpA Ribonuclease P protein component Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q97NI5 0.00028 40 30 2 92 3 rnpA Ribonuclease P protein component Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q7VSD8 0.00028 40 45 0 42 3 rnpA Ribonuclease P protein component Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W2K3 0.00028 40 45 0 42 3 rnpA Ribonuclease P protein component Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WDJ7 0.00028 40 45 0 42 3 rnpA Ribonuclease P protein component Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A0AMG4 0.00029 40 31 4 96 3 rnpA Ribonuclease P protein component Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q7UNR1 0.000305 40 37 3 78 3 rnpA Ribonuclease P protein component Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
B8DCV5 0.000339 40 31 4 96 3 rnpA Ribonuclease P protein component Listeria monocytogenes serotype 4a (strain HCC23)
B2U822 0.000409 40 41 2 73 3 rnpA Ribonuclease P protein component Ralstonia pickettii (strain 12J)
B9DI94 0.000532 39 32 1 64 3 rnpA Ribonuclease P protein component Staphylococcus carnosus (strain TM300)
A4J9S4 0.000538 39 28 2 90 3 rnpA Ribonuclease P protein component Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
B9DVV7 0.000548 39 28 1 88 3 rnpA Ribonuclease P protein component Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q9PLD7 0.000814 39 34 3 84 3 rnpA Ribonuclease P protein component Chlamydia muridarum (strain MoPn / Nigg)
B5ZCB8 0.001 39 27 0 70 3 rnpA Ribonuclease P protein component Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_16160
Feature type CDS
Gene rnpA
Product ribonuclease P protein component
Location 48709 - 49035 (strand: 1)
Length 327 (nucleotides) / 108 (amino acids)

Contig

Accession ZDB_696
Length 80662 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2085
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00825 Ribonuclease P

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0594 Translation, ribosomal structure and biogenesis (J) J RNase P protein component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03536 ribonuclease P protein component [EC:3.1.26.5] - -

Protein Sequence

MLTPEHFNFVFRQPQRASTPEITLLGRRNELEHPRIGLTVAKKNVKRAHERNRIKRLAREYFRLHQHELPDMDFVLLVRKGVSELSNREITEALGKLWRRHSRLAHAS

Flanking regions ( +/- flanking 50bp)

AATAAAGCTAACCATACGTGGTTAAGCTCGCTTTTCCGAGGGAGTTACGTTTGTTAACTCCCGAGCATTTCAACTTTGTCTTCCGGCAACCACAACGGGCAAGTACTCCTGAAATAACACTTCTGGGACGCCGTAATGAGCTGGAACATCCCCGCATTGGTCTTACCGTCGCTAAAAAAAACGTTAAACGGGCTCATGAGCGCAATCGCATTAAACGGTTAGCGCGTGAATACTTTCGTCTGCACCAACATGAGTTGCCCGATATGGATTTCGTGCTTCTGGTAAGAAAAGGGGTATCGGAGTTGAGTAATCGCGAGATTACGGAAGCATTGGGTAAGTTATGGCGTCGTCACAGTCGCTTGGCGCACGCTTCCTGATCCTGTTAATCAGAGGTTACCAGCTGGTGATAAGTCCGCTGCTGGGACCA