Homologs in group_3317

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10905 FBDBKF_10905 100.0 Morganella morganii S1 ydcZ DUF606 domain-containing protein
EHELCC_05320 EHELCC_05320 100.0 Morganella morganii S2 ydcZ DUF606 domain-containing protein
NLDBIP_05640 NLDBIP_05640 100.0 Morganella morganii S4 ydcZ DUF606 domain-containing protein
LHKJJB_02520 LHKJJB_02520 100.0 Morganella morganii S3 ydcZ DUF606 domain-containing protein

Distribution of the homologs in the orthogroup group_3317

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3317

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_15900
Feature type CDS
Gene ydcZ
Product DUF606 domain-containing protein
Location 92548 - 93000 (strand: 1)
Length 453 (nucleotides) / 150 (amino acids)
In genomic island -

Contig

Accession ZDB_695
Length 101591 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3317
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF04657 Putative inner membrane exporter, YdcZ

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3238 Function unknown (S) S Uncharacterized membrane protein YdcZ, DUF606 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09936 bacterial/archaeal transporter family-2 protein Quorum sensing -

Protein Sequence

MKKEILLPLIALLSGVLLTLMIMSNSYLSTFTSPLHASWLTHGIGAIVALIIWLTVKKHLPPRHAGTKMPLWCYLGGIPGAFTVLLAAITVNSPLSLSGSIVLMLAGQIVTGLIIDHFGLMGLTRRKVTSRDGLTLLLLFSGCILIIAGK

Flanking regions ( +/- flanking 50bp)

GCCCCGGCAATCTCTATACTCTCTCCGTCCGCAATAAAGTGAAAATAACGATGAAAAAAGAGATCCTGTTACCGCTGATAGCCTTACTTTCCGGGGTATTACTCACCCTGATGATTATGAGCAACAGCTATTTATCCACCTTTACTTCTCCGCTGCACGCCTCCTGGCTGACACACGGCATCGGTGCCATTGTTGCCCTGATTATCTGGCTGACAGTGAAAAAGCACCTGCCGCCACGCCACGCCGGTACAAAAATGCCGCTGTGGTGCTATCTCGGCGGGATACCCGGTGCGTTTACCGTACTGCTGGCGGCGATCACCGTTAACAGCCCGCTGTCACTCTCCGGCTCGATTGTACTGATGCTTGCGGGGCAGATAGTGACCGGGCTGATTATCGACCATTTTGGTCTGATGGGACTGACACGGCGCAAAGTGACAAGCCGCGACGGGCTGACACTGCTGCTGTTATTCAGCGGCTGTATTTTGATCATTGCAGGAAAATAATGATGTTACTGTTTTATATTACTATCGCGCTGACAAATGGCATTTGTATT