Homologs in group_3336

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11230 FBDBKF_11230 100.0 Morganella morganii S1 - hypothetical protein
EHELCC_17985 EHELCC_17985 100.0 Morganella morganii S2 - hypothetical protein
NLDBIP_05315 NLDBIP_05315 100.0 Morganella morganii S4 - hypothetical protein
LHKJJB_02195 LHKJJB_02195 100.0 Morganella morganii S3 - hypothetical protein

Distribution of the homologs in the orthogroup group_3336

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3336

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_15575
Feature type CDS
Gene -
Product hypothetical protein
Location 38111 - 38233 (strand: 1)
Length 123 (nucleotides) / 40 (amino acids)

Contig

Accession ZDB_695
Length 101591 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3336
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MSKQESIAKMLKLANRLDEIVAELTAKKDEMFSEAYSKAA

Flanking regions ( +/- flanking 50bp)

TTTAATGTACGTACCCCCAACGAGCGAGTAAAGGAAACTAGGAGCACATCATGTCCAAACAAGAGAGCATTGCAAAAATGTTGAAGCTTGCAAACCGTCTGGATGAAATCGTCGCAGAGCTGACTGCAAAAAAAGACGAAATGTTCAGCGAAGCATATAGCAAAGCAGCGTAATCCTATCGCCCTACAAATTAGCAAGCTTTCCTCAGTAAAAAAGCCCTCTC