Homologs in group_3337

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_17985 EHELCC_17985 100.0 Morganella morganii S2 - hypothetical protein
NLDBIP_05315 NLDBIP_05315 100.0 Morganella morganii S4 - hypothetical protein
LHKJJB_02195 LHKJJB_02195 100.0 Morganella morganii S3 - hypothetical protein
HKOGLL_15575 HKOGLL_15575 100.0 Morganella morganii S5 - hypothetical protein

Distribution of the homologs in the orthogroup group_3337

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3337

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_11230
Feature type CDS
Gene -
Product hypothetical protein
Location 63272 - 63394 (strand: -1)
Length 123 (nucleotides) / 40 (amino acids)
In genomic island GI33

Contig

Accession contig_13
Length 135581 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3337
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MSKQESIAKMLKLANRLDEIVAELTAKKDEMFSEAYSKAA

Flanking regions ( +/- flanking 50bp)

TTTAATGTACGTACCCCCAACGAGCGAGTAAAGGAAACTAGGAGCACATCATGTCCAAACAAGAGAGCATTGCAAAAATGTTGAAGCTTGCAAACCGTCTGGATGAAATCGTCGCAGAGCTGACTGCAAAAAAAGACGAAATGTTCAGCGAAGCATATAGCAAAGCAGCGTAATCCTATCGCCCTACAAATTAGCAAGCTTTCCTCAGTAAAAAAGCCCTCTC