Homologs in group_1707

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11895 FBDBKF_11895 100.0 Morganella morganii S1 yihD DUF1040 domain-containing protein
EHELCC_14410 EHELCC_14410 100.0 Morganella morganii S2 yihD DUF1040 domain-containing protein
NLDBIP_15505 NLDBIP_15505 100.0 Morganella morganii S4 yihD DUF1040 domain-containing protein
LHKJJB_15105 LHKJJB_15105 100.0 Morganella morganii S3 yihD DUF1040 domain-containing protein
F4V73_RS14760 F4V73_RS14760 94.4 Morganella psychrotolerans - YihD family protein
PMI_RS13980 PMI_RS13980 82.0 Proteus mirabilis HI4320 - YihD family protein

Distribution of the homologs in the orthogroup group_1707

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1707

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ADP9 4.76e-46 145 77 0 89 1 yihD Protein YihD Escherichia coli (strain K12)
P0ADQ0 4.76e-46 145 77 0 89 4 yihD Protein YihD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ADQ1 4.76e-46 145 77 0 89 4 yihD Protein YihD Escherichia coli O157:H7
P44900 6.23e-39 127 65 0 88 4 HI_0845 Uncharacterized protein HI_0845 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_14225
Feature type CDS
Gene yihD
Product DUF1040 domain-containing protein
Location 16894 - 17163 (strand: -1)
Length 270 (nucleotides) / 89 (amino acids)

Contig

Accession ZDB_693
Length 123756 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1707
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06288 Protein of unknown function (DUF1040)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3084 Function unknown (S) S Uncharacterized conserved protein YihD, DUF1040 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09896 uncharacterized protein - -

Protein Sequence

MKCHRLNEVIELLHPVWQQHSDLNLMQMLQKLADEAGFEGELSDLTDDILIYHLKMRGSEATDAIPGLKKDYEEDFKTALLRARGIIKE

Flanking regions ( +/- flanking 50bp)

GCGGCGGATAATTGGTAATGTGTTACGATCTTGCTTATAAGGAATTTATTATGAAATGTCATCGTCTTAATGAGGTTATCGAACTTCTGCACCCTGTCTGGCAGCAACATTCTGATCTGAACCTGATGCAGATGTTACAGAAACTGGCTGACGAAGCCGGGTTTGAGGGTGAATTATCTGACCTGACCGATGATATTCTTATTTATCACCTGAAAATGCGCGGCTCTGAGGCAACAGACGCCATTCCGGGTCTGAAAAAAGATTACGAAGAAGATTTTAAAACCGCCCTGTTACGTGCACGCGGCATCATCAAAGAGTAATGCAGACGATTACCCCGCCGGTTTTCACTTTTCAGGATTTCCGGCCTGAC