Homologs in group_1707

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11895 FBDBKF_11895 82.0 Morganella morganii S1 yihD DUF1040 domain-containing protein
EHELCC_14410 EHELCC_14410 82.0 Morganella morganii S2 yihD DUF1040 domain-containing protein
NLDBIP_15505 NLDBIP_15505 82.0 Morganella morganii S4 yihD DUF1040 domain-containing protein
LHKJJB_15105 LHKJJB_15105 82.0 Morganella morganii S3 yihD DUF1040 domain-containing protein
HKOGLL_14225 HKOGLL_14225 82.0 Morganella morganii S5 yihD DUF1040 domain-containing protein
F4V73_RS14760 F4V73_RS14760 78.7 Morganella psychrotolerans - YihD family protein

Distribution of the homologs in the orthogroup group_1707

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1707

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ADP9 4.67e-45 142 75 0 89 1 yihD Protein YihD Escherichia coli (strain K12)
P0ADQ0 4.67e-45 142 75 0 89 4 yihD Protein YihD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ADQ1 4.67e-45 142 75 0 89 4 yihD Protein YihD Escherichia coli O157:H7
P44900 6.67e-36 119 62 0 88 4 HI_0845 Uncharacterized protein HI_0845 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS13980
Feature type CDS
Gene -
Product YihD family protein
Location 3105331 - 3105600 (strand: -1)
Length 270 (nucleotides) / 89 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1707
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06288 Protein of unknown function (DUF1040)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3084 Function unknown (S) S Uncharacterized conserved protein YihD, DUF1040 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09896 uncharacterized protein - -

Protein Sequence

MKCHRLNEVMELLHPVWEEHSDLNLVQLLQKLADEAGFKGQLADLTDDILIYHLKMRNTAPTDVIPGLKKDYEEDFKTAILRARGVIKD

Flanking regions ( +/- flanking 50bp)

TAGAGAATACTTGGTACTTTGTTGTTATTTTAATAATAAGGATTTTTTGTATGAAATGTCACCGTCTTAATGAAGTGATGGAATTATTGCACCCAGTATGGGAAGAGCATTCTGATTTAAACTTAGTTCAATTATTACAGAAACTGGCGGATGAAGCAGGTTTTAAAGGTCAACTTGCTGATCTAACTGATGATATTTTGATCTATCATCTAAAAATGCGCAATACCGCACCCACAGATGTTATTCCTGGGCTGAAGAAAGATTATGAAGAAGATTTCAAAACAGCTATTTTACGTGCTCGCGGTGTGATTAAAGATTAATTTCAGGATAGGACATGGCCATATCTGCCTCATTTAATTTTCAAGGATTG