Homologs in group_1577

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09865 FBDBKF_09865 100.0 Morganella morganii S1 - DUF2517 domain-containing protein
EHELCC_04665 EHELCC_04665 100.0 Morganella morganii S2 - DUF2517 domain-containing protein
NLDBIP_04665 NLDBIP_04665 100.0 Morganella morganii S4 - DUF2517 domain-containing protein
LHKJJB_13965 LHKJJB_13965 100.0 Morganella morganii S3 - DUF2517 domain-containing protein
F4V73_RS00480 F4V73_RS00480 85.7 Morganella psychrotolerans - YbfA family protein
PMI_RS02730 PMI_RS02730 60.3 Proteus mirabilis HI4320 - YbfA family protein

Distribution of the homologs in the orthogroup group_1577

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1577

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AAU4 4.01e-23 85 59 0 66 3 ybfA Uncharacterized protein YbfA Shigella flexneri
P0AAU2 4.01e-23 85 59 0 66 3 ybfA Uncharacterized protein YbfA Escherichia coli (strain K12)
P0AAU3 4.01e-23 85 59 0 66 3 ybfA Uncharacterized protein YbfA Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_12570
Feature type CDS
Gene -
Product DUF2517 domain-containing protein
Location 70875 - 71087 (strand: -1)
Length 213 (nucleotides) / 70 (amino acids)
In genomic island -

Contig

Accession ZDB_690
Length 144397 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1577
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF10725 Protein of unknown function (DUF2517)

Protein Sequence

MSTFQVYPLHKVLLRRTGAVSLGILAFPFMLFYRDRARFWSYLYRVWSKTSDKPVWLARSENAVSSTQQH

Flanking regions ( +/- flanking 50bp)

TTCGGTGATTATTGCTGTTCTGCGATAATCCGTTATTAAGGAGGGTCTCAATGTCAACATTTCAGGTATATCCGTTGCATAAGGTTCTCTTGCGCCGTACCGGTGCAGTATCTTTAGGTATCCTGGCGTTCCCGTTTATGCTGTTCTACCGGGATCGCGCCCGCTTCTGGAGCTATCTGTACCGTGTGTGGTCCAAGACAAGCGATAAACCGGTCTGGCTGGCACGTTCAGAAAATGCGGTAAGCAGTACCCAGCAGCACTGATACCGGCATCCGGAAAGCAAAAGAGACGCCCGGCGATGTTATCGCGGGGC