Homologs in group_1488

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09605 FBDBKF_09605 100.0 Morganella morganii S1 bioD dethiobiotin synthase
EHELCC_04405 EHELCC_04405 100.0 Morganella morganii S2 bioD dethiobiotin synthase
NLDBIP_04405 NLDBIP_04405 100.0 Morganella morganii S4 bioD dethiobiotin synthase
LHKJJB_14225 LHKJJB_14225 100.0 Morganella morganii S3 bioD dethiobiotin synthase
F4V73_RS00735 F4V73_RS00735 77.9 Morganella psychrotolerans bioD dethiobiotin synthase
PMI_RS02985 PMI_RS02985 60.6 Proteus mirabilis HI4320 bioD dethiobiotin synthase

Distribution of the homologs in the orthogroup group_1488

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1488

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8X821 1.34e-98 289 64 1 222 3 bioD1 ATP-dependent dethiobiotin synthetase BioD 1 Escherichia coli O157:H7
P13000 3.37e-98 288 64 1 222 1 bioD1 ATP-dependent dethiobiotin synthetase BioD 1 Escherichia coli (strain K12)
A9R3D1 9.81e-93 275 59 1 229 3 bioD ATP-dependent dethiobiotin synthetase BioD Yersinia pestis bv. Antiqua (strain Angola)
Q8ZGW9 9.81e-93 275 59 1 229 3 bioD1 ATP-dependent dethiobiotin synthetase BioD 1 Yersinia pestis
Q8ZQQ5 1.55e-91 271 61 1 222 3 bioD1 ATP-dependent dethiobiotin synthetase BioD 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z890 1.55e-90 268 61 1 222 3 bioD1 ATP-dependent dethiobiotin synthetase BioD 1 Salmonella typhi
P36572 9.06e-89 264 57 1 227 3 bioD ATP-dependent dethiobiotin synthetase BioD Serratia marcescens
O06899 1.11e-88 264 62 1 222 3 bioD ATP-dependent dethiobiotin synthetase BioD Pseudescherichia vulneris
Q1LTL5 1.12e-67 210 48 0 221 3 bioD ATP-dependent dethiobiotin synthetase BioD Baumannia cicadellinicola subsp. Homalodisca coagulata
Q87QN3 1.53e-66 207 45 0 219 3 bioD ATP-dependent dethiobiotin synthetase BioD Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B5EUP7 7.8e-65 203 43 0 217 3 bioD ATP-dependent dethiobiotin synthetase BioD Aliivibrio fischeri (strain MJ11)
Q5DZI1 7.8e-65 203 43 0 217 3 bioD ATP-dependent dethiobiotin synthetase BioD Aliivibrio fischeri (strain ATCC 700601 / ES114)
A7MX33 8.68e-65 203 44 0 219 3 bioD ATP-dependent dethiobiotin synthetase BioD Vibrio campbellii (strain ATCC BAA-1116)
Q7MLU7 3.33e-63 199 44 0 219 3 bioD ATP-dependent dethiobiotin synthetase BioD Vibrio vulnificus (strain YJ016)
Q8D8N2 3.33e-63 199 44 0 219 3 bioD ATP-dependent dethiobiotin synthetase BioD Vibrio vulnificus (strain CMCP6)
Q6LPR5 1.14e-62 197 45 0 208 3 bioD ATP-dependent dethiobiotin synthetase BioD Photobacterium profundum (strain SS9)
B6ESC4 1.3e-62 197 42 0 219 3 bioD ATP-dependent dethiobiotin synthetase BioD Aliivibrio salmonicida (strain LFI1238)
Q9KSZ1 6.46e-62 196 42 0 221 3 bioD ATP-dependent dethiobiotin synthetase BioD Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P69954 1.37e-61 195 47 1 216 3 bioD ATP-dependent dethiobiotin synthetase BioD Yersinia pseudotuberculosis serotype I (strain IP32953)
P69953 1.37e-61 195 47 1 216 3 bioD2 ATP-dependent dethiobiotin synthetase BioD 2 Yersinia pestis
P57377 5.36e-59 188 40 1 210 3 bioD ATP-dependent dethiobiotin synthetase BioD Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D982 1.03e-58 187 40 1 210 3 bioD ATP-dependent dethiobiotin synthetase BioD Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A4SPR4 6.66e-58 186 43 1 220 3 bioD ATP-dependent dethiobiotin synthetase BioD Aeromonas salmonicida (strain A449)
A0KIC9 2.43e-57 184 43 1 220 3 bioD ATP-dependent dethiobiotin synthetase BioD Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q8ZPK6 4.13e-57 184 42 2 222 3 bioD2 ATP-dependent dethiobiotin synthetase BioD 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A6E9 7.35e-57 183 43 2 222 3 bioD2 ATP-dependent dethiobiotin synthetase BioD 2 Escherichia coli (strain K12)
P0A6F0 7.35e-57 183 43 2 222 3 bioD2 ATP-dependent dethiobiotin synthetase BioD 2 Escherichia coli O157:H7
Q8Z6X9 7.93e-57 183 42 2 222 3 bioD2 ATP-dependent dethiobiotin synthetase BioD 2 Salmonella typhi
Q1QYD9 5.39e-56 181 43 4 237 3 bioD ATP-dependent dethiobiotin synthetase BioD Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
P59564 2.42e-55 179 38 0 213 3 bioD ATP-dependent dethiobiotin synthetase BioD Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q9CN08 2.97e-55 179 42 2 231 3 bioD1 ATP-dependent dethiobiotin synthetase BioD 1 Pasteurella multocida (strain Pm70)
Q5NZF8 3.59e-54 176 43 0 218 3 bioD ATP-dependent dethiobiotin synthetase BioD Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B3PI90 6.55e-54 175 48 0 208 3 bioD ATP-dependent dethiobiotin synthetase BioD Cellvibrio japonicus (strain Ueda107)
Q8D298 1.06e-53 175 34 2 222 3 bioD ATP-dependent dethiobiotin synthetase BioD Wigglesworthia glossinidia brevipalpis
Q65TU7 1.29e-53 175 41 4 228 3 bioD ATP-dependent dethiobiotin synthetase BioD Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
C4LDD0 1.63e-53 174 41 1 223 3 bioD ATP-dependent dethiobiotin synthetase BioD Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q02TR2 3.65e-51 168 47 1 218 3 bioD ATP-dependent dethiobiotin synthetase BioD Pseudomonas aeruginosa (strain UCBPP-PA14)
Q9I614 1.01e-50 167 46 1 218 3 bioD ATP-dependent dethiobiotin synthetase BioD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A6UYW4 1.58e-50 167 49 1 204 3 bioD ATP-dependent dethiobiotin synthetase BioD Pseudomonas aeruginosa (strain PA7)
B7V489 5.42e-50 165 46 1 218 3 bioD ATP-dependent dethiobiotin synthetase BioD Pseudomonas aeruginosa (strain LESB58)
Q7VLG6 5.04e-48 162 38 2 228 3 bioD1 ATP-dependent dethiobiotin synthetase BioD 1 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P45209 5.35e-48 160 40 4 232 3 bioD1 ATP-dependent dethiobiotin synthetase BioD 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A6VND6 2.2e-45 154 38 5 228 3 bioD ATP-dependent dethiobiotin synthetase BioD Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B4S0P6 1.04e-44 152 40 3 213 3 bioD ATP-dependent dethiobiotin synthetase BioD Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B0U3W7 2.82e-44 150 42 0 213 3 bioD ATP-dependent dethiobiotin synthetase BioD Xylella fastidiosa (strain M12)
Q3IGS9 3.3e-44 150 41 1 203 3 bioD ATP-dependent dethiobiotin synthetase BioD Pseudoalteromonas translucida (strain TAC 125)
Q87BG0 3.46e-44 150 42 0 213 3 bioD ATP-dependent dethiobiotin synthetase BioD Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9PAL9 6.34e-44 150 42 0 213 3 bioD ATP-dependent dethiobiotin synthetase BioD Xylella fastidiosa (strain 9a5c)
A1U4A9 3.01e-42 145 39 2 223 3 bioD ATP-dependent dethiobiotin synthetase BioD Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q2Y9Y5 1.37e-41 144 37 2 221 3 bioD ATP-dependent dethiobiotin synthetase BioD Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q5QZ19 7.13e-40 139 38 2 219 3 bioD ATP-dependent dethiobiotin synthetase BioD Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A9AE45 1.77e-39 139 40 1 208 3 bioD ATP-dependent dethiobiotin synthetase BioD Burkholderia multivorans (strain ATCC 17616 / 249)
B2UNC5 5.72e-37 131 35 3 217 3 bioD ATP-dependent dethiobiotin synthetase BioD Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
A4JIB6 3.99e-35 127 41 1 206 3 bioD ATP-dependent dethiobiotin synthetase BioD Burkholderia vietnamiensis (strain G4 / LMG 22486)
B2UBJ4 6.36e-35 127 38 0 207 3 bioD ATP-dependent dethiobiotin synthetase BioD Ralstonia pickettii (strain 12J)
Q9KER6 1.07e-34 126 33 4 213 3 bioD ATP-dependent dethiobiotin synthetase BioD Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q5X589 2.83e-34 124 37 4 201 3 bioD ATP-dependent dethiobiotin synthetase BioD Legionella pneumophila (strain Paris)
A6SU65 8.16e-34 124 35 3 229 3 bioD ATP-dependent dethiobiotin synthetase BioD Janthinobacterium sp. (strain Marseille)
B4E9L5 1.09e-33 124 39 1 208 3 bioD ATP-dependent dethiobiotin synthetase BioD Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
B2SQ77 1.04e-32 121 44 0 218 3 bioD ATP-dependent dethiobiotin synthetase BioD Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P7M5 1.04e-32 121 44 0 218 3 bioD ATP-dependent dethiobiotin synthetase BioD Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q5WWA0 2.2e-32 120 36 4 201 3 bioD ATP-dependent dethiobiotin synthetase BioD Legionella pneumophila (strain Lens)
Q5ZVG5 3.13e-32 119 35 4 201 3 bioD ATP-dependent dethiobiotin synthetase BioD Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IBW5 4.32e-32 119 36 4 201 3 bioD ATP-dependent dethiobiotin synthetase BioD Legionella pneumophila (strain Corby)
Q8XZC2 1.17e-31 118 39 0 210 3 bioD ATP-dependent dethiobiotin synthetase BioD Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B2JKH5 1.22e-31 119 40 1 208 3 bioD ATP-dependent dethiobiotin synthetase BioD Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q63Y24 1.4e-31 118 41 1 209 3 bioD ATP-dependent dethiobiotin synthetase BioD Burkholderia pseudomallei (strain K96243)
A3N521 1.87e-31 118 41 1 209 3 bioD ATP-dependent dethiobiotin synthetase BioD Burkholderia pseudomallei (strain 668)
Q3JWR7 1.87e-31 118 41 1 209 3 bioD ATP-dependent dethiobiotin synthetase BioD Burkholderia pseudomallei (strain 1710b)
A3NQS2 1.87e-31 118 41 1 209 3 bioD ATP-dependent dethiobiotin synthetase BioD Burkholderia pseudomallei (strain 1106a)
Q39CE5 5.96e-31 117 41 1 206 3 bioD ATP-dependent dethiobiotin synthetase BioD Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q4UQI6 7.44e-31 116 41 0 218 3 bioD ATP-dependent dethiobiotin synthetase BioD Xanthomonas campestris pv. campestris (strain 8004)
A4IXP2 3.02e-30 114 33 3 174 3 bioD ATP-dependent dethiobiotin synthetase BioD Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NGB5 3.02e-30 114 33 3 174 1 bioD ATP-dependent dethiobiotin synthetase BioD Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
B2SGE0 3.02e-30 114 33 3 174 3 bioD ATP-dependent dethiobiotin synthetase BioD Francisella tularensis subsp. mediasiatica (strain FSC147)
Q14HR7 3.02e-30 114 33 3 174 3 bioD ATP-dependent dethiobiotin synthetase BioD Francisella tularensis subsp. tularensis (strain FSC 198)
A0Q635 6.17e-30 114 34 3 174 3 bioD ATP-dependent dethiobiotin synthetase BioD Francisella tularensis subsp. novicida (strain U112)
B0RVN9 6.28e-30 114 40 0 218 3 bioD ATP-dependent dethiobiotin synthetase BioD Xanthomonas campestris pv. campestris (strain B100)
Q8PCW4 7.29e-30 113 40 0 218 3 bioD ATP-dependent dethiobiotin synthetase BioD Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q0BLD2 1.89e-29 112 33 3 174 3 bioD ATP-dependent dethiobiotin synthetase BioD Francisella tularensis subsp. holarctica (strain OSU18)
Q2A2V6 1.89e-29 112 33 3 174 3 bioD ATP-dependent dethiobiotin synthetase BioD Francisella tularensis subsp. holarctica (strain LVS)
A7NCX0 1.89e-29 112 33 3 174 3 bioD ATP-dependent dethiobiotin synthetase BioD Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q3BP46 2.11e-29 112 44 0 204 3 bioD ATP-dependent dethiobiotin synthetase BioD Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B5YHS9 4.78e-29 112 29 3 226 3 bioD ATP-dependent dethiobiotin synthetase BioD Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q8PGK0 1.48e-28 110 44 0 204 3 bioD ATP-dependent dethiobiotin synthetase BioD Xanthomonas axonopodis pv. citri (strain 306)
B0U0S6 1.58e-27 107 33 3 174 3 bioD ATP-dependent dethiobiotin synthetase BioD Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q97JC5 7.81e-27 106 29 2 208 3 bioD ATP-dependent dethiobiotin synthetase BioD Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q0BBD5 2.22e-26 105 41 1 206 3 bioD ATP-dependent dethiobiotin synthetase BioD Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
A1V818 5.75e-26 103 41 1 209 3 bioD ATP-dependent dethiobiotin synthetase BioD Burkholderia mallei (strain SAVP1)
Q62MX0 5.75e-26 103 41 1 209 3 bioD ATP-dependent dethiobiotin synthetase BioD Burkholderia mallei (strain ATCC 23344)
A2S7R2 5.75e-26 103 41 1 209 3 bioD ATP-dependent dethiobiotin synthetase BioD Burkholderia mallei (strain NCTC 10229)
A3MNG2 5.75e-26 103 41 1 209 3 bioD ATP-dependent dethiobiotin synthetase BioD Burkholderia mallei (strain NCTC 10247)
B1HRT5 5.97e-26 103 30 3 208 3 bioD ATP-dependent dethiobiotin synthetase BioD Lysinibacillus sphaericus (strain C3-41)
B7GHM4 8.06e-26 103 31 5 216 3 bioD ATP-dependent dethiobiotin synthetase BioD Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q0TQ60 8.67e-26 103 26 1 214 3 bioD ATP-dependent dethiobiotin synthetase BioD Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
A0PYU7 1.45e-25 102 26 1 217 3 bioD ATP-dependent dethiobiotin synthetase BioD Clostridium novyi (strain NT)
A5N6Q7 1.52e-25 102 27 3 213 3 bioD ATP-dependent dethiobiotin synthetase BioD Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E076 1.52e-25 102 27 3 213 3 bioD ATP-dependent dethiobiotin synthetase BioD Clostridium kluyveri (strain NBRC 12016)
B1JZE0 1.72e-25 102 40 1 206 3 bioD ATP-dependent dethiobiotin synthetase BioD Burkholderia orbicola (strain MC0-3)
Q1BT35 1.74e-25 102 41 1 206 3 bioD ATP-dependent dethiobiotin synthetase BioD Burkholderia orbicola (strain AU 1054)
A0KB04 1.74e-25 102 41 1 206 3 bioD ATP-dependent dethiobiotin synthetase BioD Burkholderia cenocepacia (strain HI2424)
A7H6E5 3.13e-25 101 35 4 211 3 bioD ATP-dependent dethiobiotin synthetase BioD Anaeromyxobacter sp. (strain Fw109-5)
Q8RET9 1.31e-24 99 34 4 175 3 bioD ATP-dependent dethiobiotin synthetase BioD Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q8XK60 3.64e-24 99 25 1 214 3 bioD ATP-dependent dethiobiotin synthetase BioD Clostridium perfringens (strain 13 / Type A)
B8J7V5 5.41e-24 98 38 1 178 3 bioD ATP-dependent dethiobiotin synthetase BioD Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
B1YNS1 1.4e-23 97 40 1 206 3 bioD ATP-dependent dethiobiotin synthetase BioD Burkholderia ambifaria (strain MC40-6)
Q2IM14 4.89e-23 95 38 1 178 3 bioD ATP-dependent dethiobiotin synthetase BioD Anaeromyxobacter dehalogenans (strain 2CP-C)
A7Z5B3 5.73e-23 95 29 2 206 3 bioD ATP-dependent dethiobiotin synthetase BioD Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q7VL12 1.2e-22 94 29 2 174 3 bioD2 ATP-dependent dethiobiotin synthetase BioD 2 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B7HAZ1 3.71e-22 94 28 3 214 3 bioD ATP-dependent dethiobiotin synthetase BioD Bacillus cereus (strain B4264)
A9M388 4.16e-22 93 32 2 183 3 bioD ATP-dependent dethiobiotin synthetase BioD Neisseria meningitidis serogroup C (strain 053442)
Q9K085 4.47e-22 93 32 2 183 3 bioD ATP-dependent dethiobiotin synthetase BioD Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
B8HNL6 4.82e-22 93 37 6 216 3 bioD ATP-dependent dethiobiotin synthetase BioD Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q818W9 5.81e-22 93 28 3 214 3 bioD ATP-dependent dethiobiotin synthetase BioD Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q9JV95 7.1e-22 92 31 2 183 3 bioD ATP-dependent dethiobiotin synthetase BioD Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
B4UKM8 1.03e-21 92 37 4 211 3 bioD ATP-dependent dethiobiotin synthetase BioD Anaeromyxobacter sp. (strain K)
A1KSZ5 1.18e-21 92 32 2 183 3 bioD ATP-dependent dethiobiotin synthetase BioD Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
B7IWN2 1.26e-21 92 28 3 214 3 bioD ATP-dependent dethiobiotin synthetase BioD Bacillus cereus (strain G9842)
C5D7L1 2.29e-21 92 29 6 207 3 bioD ATP-dependent dethiobiotin synthetase BioD Geobacillus sp. (strain WCH70)
A9A5K8 2.32e-21 91 26 1 211 3 bioD ATP-dependent dethiobiotin synthetase BioD Nitrosopumilus maritimus (strain SCM1)
B4RJZ8 7.68e-21 89 31 2 183 3 bioD ATP-dependent dethiobiotin synthetase BioD Neisseria gonorrhoeae (strain NCCP11945)
Q5F9T1 7.68e-21 89 31 2 183 3 bioD ATP-dependent dethiobiotin synthetase BioD Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q65ML0 9.62e-21 90 26 2 208 3 bioD ATP-dependent dethiobiotin synthetase BioD Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A6UQL8 9.88e-21 89 29 2 180 3 bioD ATP-dependent dethiobiotin synthetase BioD Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
P53558 1.66e-20 89 27 2 204 3 bioD ATP-dependent dethiobiotin synthetase BioD Bacillus subtilis (strain 168)
A4XGB6 2.27e-20 89 30 2 175 3 bioD ATP-dependent dethiobiotin synthetase BioD Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q635G3 4.86e-20 88 28 6 222 3 bioD ATP-dependent dethiobiotin synthetase BioD Bacillus cereus (strain ZK / E33L)
C1EQZ2 5.17e-20 88 28 6 222 3 bioD ATP-dependent dethiobiotin synthetase BioD Bacillus cereus (strain 03BB102)
A0RIC0 5.17e-20 88 28 6 222 3 bioD ATP-dependent dethiobiotin synthetase BioD Bacillus thuringiensis (strain Al Hakam)
Q81MA9 1.01e-19 87 27 6 222 3 bioD ATP-dependent dethiobiotin synthetase BioD Bacillus anthracis
C3LJP5 1.01e-19 87 27 6 222 3 bioD ATP-dependent dethiobiotin synthetase BioD Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P7Q4 1.01e-19 87 27 6 222 3 bioD ATP-dependent dethiobiotin synthetase BioD Bacillus anthracis (strain A0248)
Q8KZM8 1.07e-19 87 27 2 206 3 bioD ATP-dependent dethiobiotin synthetase BioD Bacillus subtilis subsp. natto
B9MP52 1.17e-19 87 30 2 175 3 bioD ATP-dependent dethiobiotin synthetase BioD Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q6HE47 3.31e-19 86 27 6 222 3 bioD ATP-dependent dethiobiotin synthetase BioD Bacillus thuringiensis subsp. konkukian (strain 97-27)
B7JLX3 3.38e-19 86 27 6 222 3 bioD ATP-dependent dethiobiotin synthetase BioD Bacillus cereus (strain AH820)
Q9CJT7 3.56e-19 85 29 2 175 3 bioD2 ATP-dependent dethiobiotin synthetase BioD 2 Pasteurella multocida (strain Pm70)
C0QVL9 6.32e-19 85 26 2 176 3 bioD ATP-dependent dethiobiotin synthetase BioD Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
Q5KVI4 6.83e-19 85 30 4 215 3 bioD ATP-dependent dethiobiotin synthetase BioD Geobacillus kaustophilus (strain HTA426)
B0SZT0 8.66e-19 84 34 3 163 3 bioD ATP-dependent dethiobiotin synthetase BioD Caulobacter sp. (strain K31)
Q7URG0 8.84e-19 85 31 3 185 3 bioD ATP-dependent dethiobiotin synthetase BioD Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
B1H0L0 1.03e-18 84 28 3 173 3 bioD ATP-dependent dethiobiotin synthetase BioD Endomicrobium trichonymphae
B8GVE1 2.63e-18 83 30 4 186 3 bioD ATP-dependent dethiobiotin synthetase BioD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A7Z2 2.63e-18 83 30 4 186 3 bioD ATP-dependent dethiobiotin synthetase BioD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q2T1Q3 4.69e-18 83 37 1 220 3 bioD ATP-dependent dethiobiotin synthetase BioD Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q58695 5.26e-18 82 28 2 178 3 bioD ATP-dependent dethiobiotin synthetase BioD Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8F4A0 5.65e-18 82 33 4 168 3 bioD ATP-dependent dethiobiotin synthetase BioD Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72RG6 5.65e-18 82 33 4 168 3 bioD ATP-dependent dethiobiotin synthetase BioD Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
B4RFX6 6.86e-18 82 31 6 201 3 bioD ATP-dependent dethiobiotin synthetase BioD Phenylobacterium zucineum (strain HLK1)
P22818 8.6e-18 82 31 1 176 3 bioD ATP-dependent dethiobiotin synthetase BioD Lysinibacillus sphaericus
Q1QJL1 1.27e-17 81 29 8 217 3 bioD ATP-dependent dethiobiotin synthetase BioD Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
B7K5E6 1.65e-17 81 29 5 219 3 bioD ATP-dependent dethiobiotin synthetase BioD Rippkaea orientalis (strain PCC 8801 / RF-1)
Q216N4 1.68e-17 80 33 10 212 3 bioD ATP-dependent dethiobiotin synthetase BioD Rhodopseudomonas palustris (strain BisB18)
B2V168 1.77e-17 81 27 3 179 3 bioD ATP-dependent dethiobiotin synthetase BioD Clostridium botulinum (strain Alaska E43 / Type E3)
A6UVE3 2.33e-17 80 30 4 173 3 bioD ATP-dependent dethiobiotin synthetase BioD Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
C3KZ35 2.91e-17 80 23 1 197 3 bioD ATP-dependent dethiobiotin synthetase BioD Clostridium botulinum (strain 657 / Type Ba4)
P45248 2.92e-17 79 27 2 174 3 bioD2 ATP-dependent dethiobiotin synthetase BioD 2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B1KW07 7.66e-17 79 22 3 202 3 bioD ATP-dependent dethiobiotin synthetase BioD Clostridium botulinum (strain Loch Maree / Type A3)
Q893G4 8.15e-17 79 27 3 179 3 bioD ATP-dependent dethiobiotin synthetase BioD Clostridium tetani (strain Massachusetts / E88)
A5FZN7 1.1e-16 79 31 5 211 3 bioD ATP-dependent dethiobiotin synthetase BioD Acidiphilium cryptum (strain JF-5)
A5I426 2.16e-16 78 23 3 202 3 bioD ATP-dependent dethiobiotin synthetase BioD Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FVS5 2.16e-16 78 23 3 202 3 bioD ATP-dependent dethiobiotin synthetase BioD Clostridium botulinum (strain ATCC 19397 / Type A)
Q1MR97 2.98e-16 77 32 7 175 3 bioD ATP-dependent dethiobiotin synthetase BioD Lawsonia intracellularis (strain PHE/MN1-00)
Q8FPS0 2.98e-16 77 28 5 227 3 bioD ATP-dependent dethiobiotin synthetase BioD Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
B1IHH8 3.1e-16 77 23 3 202 3 bioD ATP-dependent dethiobiotin synthetase BioD Clostridium botulinum (strain Okra / Type B1)
A1AV54 3.44e-16 77 26 2 185 3 bioD ATP-dependent dethiobiotin synthetase BioD Ruthia magnifica subsp. Calyptogena magnifica
A7GFJ8 4.53e-16 77 23 3 202 3 bioD ATP-dependent dethiobiotin synthetase BioD Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
Q8CQD8 4.79e-16 77 30 6 189 3 bioD ATP-dependent dethiobiotin synthetase BioD Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HKF0 4.79e-16 77 30 6 189 3 bioD ATP-dependent dethiobiotin synthetase BioD Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q6NHE6 5.72e-16 77 30 5 190 3 bioD ATP-dependent dethiobiotin synthetase BioD Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
B0JX07 6.7e-16 77 27 4 216 3 bioD ATP-dependent dethiobiotin synthetase BioD Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
A6X2S6 9.28e-16 76 30 8 228 3 bioD ATP-dependent dethiobiotin synthetase BioD Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q051U4 2.44e-15 75 30 4 168 3 bioD ATP-dependent dethiobiotin synthetase BioD Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04RS7 2.44e-15 75 30 4 168 3 bioD ATP-dependent dethiobiotin synthetase BioD Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
A5CY11 3.45e-15 74 28 2 176 3 bioD ATP-dependent dethiobiotin synthetase BioD Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
C1FR34 4.77e-15 74 22 3 202 3 bioD ATP-dependent dethiobiotin synthetase BioD Clostridium botulinum (strain Kyoto / Type A2)
O66832 8.53e-15 73 28 6 214 3 bioD ATP-dependent dethiobiotin synthetase BioD Aquifex aeolicus (strain VF5)
Q130N3 1.57e-14 72 32 7 205 3 bioD ATP-dependent dethiobiotin synthetase BioD Rhodopseudomonas palustris (strain BisB5)
Q07L51 3.41e-14 72 33 5 166 3 bioD ATP-dependent dethiobiotin synthetase BioD Rhodopseudomonas palustris (strain BisA53)
Q9AMS4 4.26e-14 71 32 6 175 3 bioD ATP-dependent dethiobiotin synthetase BioD Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A0M7A5 4.73e-14 71 31 6 172 3 bioD ATP-dependent dethiobiotin synthetase BioD Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q3SPW7 1.11e-13 70 33 6 167 3 bioD ATP-dependent dethiobiotin synthetase BioD Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q8KGC0 1.15e-13 71 28 2 174 3 bioD ATP-dependent dethiobiotin synthetase BioD Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q2GAF9 1.2e-13 70 35 7 168 3 bioD ATP-dependent dethiobiotin synthetase BioD Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q1GT35 1.87e-13 69 31 6 173 3 bioD ATP-dependent dethiobiotin synthetase BioD Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
B4U7U3 2.34e-13 70 26 6 177 3 bioD ATP-dependent dethiobiotin synthetase BioD Hydrogenobaculum sp. (strain Y04AAS1)
Q11QU6 3.51e-13 69 29 5 174 3 bioD ATP-dependent dethiobiotin synthetase BioD Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q8U8T9 3.86e-13 69 31 10 211 3 bioD ATP-dependent dethiobiotin synthetase BioD Agrobacterium fabrum (strain C58 / ATCC 33970)
B2TL74 5.46e-13 68 25 3 186 3 bioD ATP-dependent dethiobiotin synthetase BioD Clostridium botulinum (strain Eklund 17B / Type B)
B1WZW5 5.54e-13 68 26 6 210 3 bioD ATP-dependent dethiobiotin synthetase BioD Crocosphaera subtropica (strain ATCC 51142 / BH68)
C4LIG1 1.26e-12 68 28 3 174 3 bioD ATP-dependent dethiobiotin synthetase BioD Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
B8IBW1 1.85e-12 67 31 5 195 3 bioD ATP-dependent dethiobiotin synthetase BioD Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q55849 2.5e-12 67 26 4 219 1 bioD ATP-dependent dethiobiotin synthetase BioD Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A6QBZ9 4.12e-12 66 25 4 181 3 bioD ATP-dependent dethiobiotin synthetase BioD Sulfurovum sp. (strain NBC37-1)
Q2W3K9 7.59e-12 65 32 8 183 3 bioD ATP-dependent dethiobiotin synthetase BioD Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
A5EFG7 1.3e-11 65 31 5 172 3 bioD ATP-dependent dethiobiotin synthetase BioD Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q9ZN34 3.88e-11 63 25 3 170 3 bioD ATP-dependent dethiobiotin synthetase BioD Helicobacter pylori (strain J99 / ATCC 700824)
I3R9K1 4.68e-11 63 25 1 177 3 bioD ATP-dependent dethiobiotin synthetase BioD Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4)
Q2IRY0 4.9e-11 63 29 8 205 3 bioD ATP-dependent dethiobiotin synthetase BioD Rhodopseudomonas palustris (strain HaA2)
B3Q7Q5 4.93e-11 63 30 3 166 3 bioD ATP-dependent dethiobiotin synthetase BioD Rhodopseudomonas palustris (strain TIE-1)
O24872 5.24e-11 63 25 3 170 1 bioD ATP-dependent dethiobiotin synthetase BioD Helicobacter pylori (strain ATCC 700392 / 26695)
Q6N5K3 5.4e-11 63 30 3 166 3 bioD ATP-dependent dethiobiotin synthetase BioD Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q9Z6L7 5.58e-11 63 28 8 215 3 bioD ATP-dependent dethiobiotin synthetase BioD Chlamydia pneumoniae
B6JGN8 8.65e-11 62 28 5 174 3 bioD ATP-dependent dethiobiotin synthetase BioD Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q7MAC6 9.87e-11 62 26 3 201 3 bioD ATP-dependent dethiobiotin synthetase BioD Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q8FWG5 1.47e-10 62 32 7 174 3 bioD ATP-dependent dethiobiotin synthetase BioD Brucella suis biovar 1 (strain 1330)
A9WYH0 1.47e-10 62 32 7 174 3 bioD ATP-dependent dethiobiotin synthetase BioD Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VUF9 1.47e-10 62 32 7 174 3 bioD ATP-dependent dethiobiotin synthetase BioD Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
A9MBD4 1.47e-10 62 32 7 174 3 bioD ATP-dependent dethiobiotin synthetase BioD Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
A4QH04 2.06e-10 62 26 5 175 3 bioD ATP-dependent dethiobiotin synthetase BioD Corynebacterium glutamicum (strain R)
P46397 2.62e-10 61 26 5 175 3 bioD ATP-dependent dethiobiotin synthetase BioD Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4F8D5 2.89e-10 61 30 5 203 3 bioD ATP-dependent dethiobiotin synthetase BioD Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q577P6 4.84e-10 60 31 7 174 3 bioD ATP-dependent dethiobiotin synthetase BioD Brucella abortus biovar 1 (strain 9-941)
Q2YKB6 4.84e-10 60 31 7 174 3 bioD ATP-dependent dethiobiotin synthetase BioD Brucella abortus (strain 2308)
B2SBF2 4.84e-10 60 31 7 174 3 bioD ATP-dependent dethiobiotin synthetase BioD Brucella abortus (strain S19)
Q8YBV9 5.29e-10 60 31 7 174 3 bioD ATP-dependent dethiobiotin synthetase BioD Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RL24 5.29e-10 60 31 7 174 3 bioD ATP-dependent dethiobiotin synthetase BioD Brucella melitensis biotype 2 (strain ATCC 23457)
Q5AYI6 6.12e-10 62 31 5 156 1 bioDA Bifunctional dethiobiotin synthetase/adenosylmethionine-8-amino-7-oxononanoate aminotransferase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q2GDE9 9.75e-10 60 26 10 207 3 bioD ATP-dependent dethiobiotin synthetase BioD Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
B2UW31 1.4e-09 59 26 3 160 3 bioD ATP-dependent dethiobiotin synthetase BioD Helicobacter pylori (strain Shi470)
Q2KXN6 1.8e-09 60 31 6 169 3 bioCD Biotin biosynthesis bifunctional protein BioCD Bordetella avium (strain 197N)
B7KBS1 3.99e-09 58 27 4 211 3 bioD ATP-dependent dethiobiotin synthetase BioD Gloeothece citriformis (strain PCC 7424)
C1A0S6 5e-09 58 34 4 172 3 bioD ATP-dependent dethiobiotin synthetase BioD Rhodococcus erythropolis (strain PR4 / NBRC 100887)
B2HQ91 1e-08 57 30 7 198 3 bioD ATP-dependent dethiobiotin synthetase BioD Mycobacterium marinum (strain ATCC BAA-535 / M)
Q5HWG3 1.05e-08 56 25 5 170 3 bioD ATP-dependent dethiobiotin synthetase BioD Campylobacter jejuni (strain RM1221)
A1VY27 1.05e-08 56 25 5 170 3 bioD ATP-dependent dethiobiotin synthetase BioD Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PIJ1 1.05e-08 56 25 5 170 3 bioD ATP-dependent dethiobiotin synthetase BioD Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FK97 1.05e-08 56 25 5 170 3 bioD ATP-dependent dethiobiotin synthetase BioD Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q0SHV6 2.87e-08 55 33 3 171 3 bioD ATP-dependent dethiobiotin synthetase BioD Rhodococcus jostii (strain RHA1)
A0PP03 3.35e-08 55 31 7 184 3 bioD ATP-dependent dethiobiotin synthetase BioD Mycobacterium ulcerans (strain Agy99)
A5V5Q4 3.38e-08 55 30 9 209 3 bioD ATP-dependent dethiobiotin synthetase BioD Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
B5YL83 4.76e-08 56 24 7 237 3 cobQ Cobyric acid synthase Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q5YYS5 6.01e-08 55 32 6 177 3 bioD ATP-dependent dethiobiotin synthetase BioD Nocardia farcinica (strain IFM 10152)
B1MBZ5 1.65e-07 53 29 7 207 3 bioD ATP-dependent dethiobiotin synthetase BioD Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q9FCC1 3.6e-07 52 31 4 203 3 bioD ATP-dependent dethiobiotin synthetase BioD Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q255H0 1.34e-06 50 29 8 177 3 bioD ATP-dependent dethiobiotin synthetase BioD Chlamydia felis (strain Fe/C-56)
P45486 4.27e-06 49 29 4 169 3 bioD ATP-dependent dethiobiotin synthetase BioD Mycobacterium leprae (strain TN)
B8ZR85 4.27e-06 49 29 4 169 3 bioD ATP-dependent dethiobiotin synthetase BioD Mycobacterium leprae (strain Br4923)
Q5L5F7 5.89e-06 48 28 6 174 3 bioD ATP-dependent dethiobiotin synthetase BioD Chlamydia abortus (strain DSM 27085 / S26/3)
A0QX66 7.36e-06 48 30 6 208 3 bioD ATP-dependent dethiobiotin synthetase BioD Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q2J6H9 8.19e-06 48 37 2 102 3 bioD ATP-dependent dethiobiotin synthetase BioD Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
A0QHJ8 1.05e-05 48 31 3 170 3 bioD ATP-dependent dethiobiotin synthetase BioD Mycobacterium avium (strain 104)
A3Q145 1.47e-05 48 32 7 188 3 bioD ATP-dependent dethiobiotin synthetase BioD Mycobacterium sp. (strain JLS)
Q826T4 1.7e-05 47 30 5 178 3 bioD ATP-dependent dethiobiotin synthetase BioD Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q7NFL5 3.02e-05 47 27 3 206 3 bioD ATP-dependent dethiobiotin synthetase BioD Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
A4JGX5 5.11e-05 47 26 8 227 3 cobQ Cobyric acid synthase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q1B7F1 6.02e-05 46 31 8 209 3 bioD ATP-dependent dethiobiotin synthetase BioD Mycobacterium sp. (strain MCS)
A1UHM2 6.02e-05 46 31 8 209 3 bioD ATP-dependent dethiobiotin synthetase BioD Mycobacterium sp. (strain KMS)
A8L2N1 6.28e-05 46 30 4 172 3 bioD ATP-dependent dethiobiotin synthetase BioD Parafrankia sp. (strain EAN1pec)
A4T9L2 7.07e-05 46 29 6 167 3 bioD ATP-dependent dethiobiotin synthetase BioD Mycolicibacterium gilvum (strain PYR-GCK)
B5ZT17 0.000108 46 23 6 227 3 cobQ Cobyric acid synthase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
A1S3L6 0.000155 45 27 9 233 3 cobQ Cobyric acid synthase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q0BCS3 0.000176 45 26 8 227 3 cobQ Cobyric acid synthase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
A1T8U7 0.000282 44 28 7 193 3 bioD ATP-dependent dethiobiotin synthetase BioD Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q1GPG1 0.000363 44 26 9 225 3 cobQ Cobyric acid synthase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q1MFE8 0.00041 44 23 8 228 3 cobQ Cobyric acid synthase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B2JER3 0.00044 44 26 9 229 3 cobQ Cobyric acid synthase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
B6ES52 0.000523 44 25 8 232 3 cobQ Cobyric acid synthase Aliivibrio salmonicida (strain LFI1238)
B3EJS3 0.000796 43 22 5 225 3 cobQ Cobyric acid synthase Chlorobium phaeobacteroides (strain BS1)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_12310
Feature type CDS
Gene bioD
Product dethiobiotin synthase
Location 20705 - 21388 (strand: -1)
Length 684 (nucleotides) / 227 (amino acids)

Contig

Accession ZDB_690
Length 144397 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1488
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13500 AAA domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0132 Coenzyme transport and metabolism (H) H Dethiobiotin synthetase

Kegg Ortholog Annotation(s)

Protein Sequence

MLKNNWFLTGTDTDAGKTVVSCALLQTARNAGFCCAGYKPVASGSEMTEEGLRNSDALALWRHTVPAVSYAQINPYTFAEPTSPHIVSELTQTPLEFSVMTDGLHALNQQADWVLTEGAGGWFTPLSATQSYADWAAQMRMPVILVVGVKLGCINHALLTVLAIQQAGLTLAGWVANEVTPPGLRQPEYLATLNNQIPAPCLGVLPHLPDPMNQDLSGYLSLPVSAH

Flanking regions ( +/- flanking 50bp)

CGAAGACGGCGTATTTCCGCTCAGCTATCTTATTCAGTACGGAGTCATACATGTTGAAAAATAACTGGTTTTTAACCGGCACCGATACGGATGCCGGTAAAACCGTGGTCAGCTGCGCCCTGCTGCAAACGGCCCGCAACGCCGGTTTCTGCTGCGCGGGGTATAAGCCGGTAGCCTCGGGCAGTGAGATGACGGAGGAGGGGCTGCGCAACAGTGATGCACTGGCATTGTGGCGGCATACGGTACCGGCGGTCAGTTACGCGCAGATTAACCCCTATACCTTTGCCGAGCCGACATCACCACACATTGTCAGCGAACTGACTCAAACCCCGCTGGAATTTTCGGTGATGACTGACGGGCTGCATGCCTTAAATCAGCAGGCTGACTGGGTACTGACCGAAGGGGCGGGCGGATGGTTTACGCCGCTGTCGGCCACACAAAGTTATGCGGACTGGGCGGCACAAATGCGGATGCCGGTGATCCTGGTCGTCGGGGTGAAGCTCGGCTGCATTAATCACGCGTTACTGACTGTACTGGCGATACAGCAGGCCGGACTGACCCTGGCGGGCTGGGTGGCGAATGAAGTCACACCGCCGGGCCTGCGTCAGCCGGAGTATCTGGCGACACTGAATAACCAGATCCCGGCACCGTGCCTGGGTGTGTTACCGCATCTGCCGGACCCGATGAATCAGGACTTATCCGGCTATCTTTCACTGCCGGTTTCCGCGCACTGATCCTGCATCCGGACGGATCGTGCCGGGATCACGGCAAATCTTCCGGCCGG