Homologs in group_1484

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09575 FBDBKF_09575 100.0 Morganella morganii S1 moaD molybdopterin synthase sulfur carrier subunit
EHELCC_04375 EHELCC_04375 100.0 Morganella morganii S2 moaD molybdopterin synthase sulfur carrier subunit
NLDBIP_04375 NLDBIP_04375 100.0 Morganella morganii S4 moaD molybdopterin synthase sulfur carrier subunit
LHKJJB_14255 LHKJJB_14255 100.0 Morganella morganii S3 moaD molybdopterin synthase sulfur carrier subunit
F4V73_RS00770 F4V73_RS00770 88.9 Morganella psychrotolerans moaD molybdopterin synthase sulfur carrier subunit
PMI_RS03015 PMI_RS03015 71.6 Proteus mirabilis HI4320 moaD molybdopterin synthase sulfur carrier subunit

Distribution of the homologs in the orthogroup group_1484

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1484

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P30748 8.6e-35 116 67 0 81 1 moaD Molybdopterin synthase sulfur carrier subunit Escherichia coli (strain K12)
P45309 1.51e-31 108 58 0 81 3 moaD Molybdopterin synthase sulfur carrier subunit Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O31706 5.14e-11 56 36 2 82 3 moaD Molybdopterin synthase sulfur carrier subunit Bacillus subtilis (strain 168)
Q54NM8 1.71e-07 47 33 3 83 3 mocs2s Molybdopterin synthase sulfur carrier subunit Dictyostelium discoideum
A8JJB2 7e-07 45 40 4 85 3 CHLREDRAFT_109356 Molybdopterin synthase sulfur carrier subunit Chlamydomonas reinhardtii
B4PUD0 3.88e-06 43 37 5 85 3 Mocs2A Molybdopterin synthase sulfur carrier subunit Drosophila yakuba
B3P6R4 8.81e-06 43 37 5 85 3 Mocs2A Molybdopterin synthase sulfur carrier subunit Drosophila erecta
Q7A441 8.93e-06 42 30 2 81 1 moaD Molybdopterin synthase sulfur carrier subunit Staphylococcus aureus (strain N315)
B6SXF8 2.93e-05 41 31 2 82 2 VP15 Molybdopterin synthase sulfur carrier subunit Zea mays
Q5TT27 3.31e-05 41 31 4 86 3 Mocs2 Molybdopterin synthase sulfur carrier subunit Anopheles gambiae
Q1DGL5 4.88e-05 41 31 3 87 3 Mocs2-1 Molybdopterin synthase sulfur carrier subunit Aedes aegypti
L7N6B4 0.000103 40 33 2 81 3 moaD1 Molybdopterin synthase sulfur carrier subunit Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P0C919 0.000108 40 32 4 85 3 Mocs2A Molybdopterin synthase sulfur carrier subunit Drosophila melanogaster
B3M269 0.000109 40 36 5 85 3 Mocs2A Molybdopterin synthase sulfur carrier subunit Drosophila ananassae
B4QUC1 0.000154 39 32 4 85 3 Mocs2A Molybdopterin synthase sulfur carrier subunit Drosophila simulans
B4IJG8 0.000185 39 35 5 85 3 Mocs2A Molybdopterin synthase sulfur carrier subunit Drosophila sechellia

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_12280
Feature type CDS
Gene moaD
Product molybdopterin synthase sulfur carrier subunit
Location 14296 - 14541 (strand: -1)
Length 246 (nucleotides) / 81 (amino acids)

Contig

Accession ZDB_690
Length 144397 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1484
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02597 ThiS family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1977 Coenzyme transport and metabolism (H) H Molybdopterin synthase sulfur carrier subunit MoaD

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03636 sulfur-carrier protein Sulfur relay system -

Protein Sequence

MIKVLFFAQVRELVNTDELSLPCDYATAEDLRAALCERGERWALALESGKLLCAVNQSFVPLSHPLTDGDEVAFFPPVTGG

Flanking regions ( +/- flanking 50bp)

CGTTTACTGGAAAAAAGCGGCGGGAAATCAGGACATTTTAAGGCGGACGCATGATTAAGGTACTGTTTTTCGCGCAGGTGCGCGAGCTGGTGAATACCGATGAGCTTTCTCTGCCGTGTGATTACGCCACAGCGGAAGATTTGCGGGCTGCGCTGTGTGAGCGCGGTGAACGCTGGGCACTGGCGCTGGAATCCGGCAAACTGCTGTGTGCGGTGAATCAGTCTTTTGTGCCGTTGTCGCATCCGCTGACAGATGGTGACGAAGTTGCGTTCTTTCCGCCGGTCACCGGAGGCTGAGCCATGAATAATACCCGGATTGCTGTTCAGACGGACAATTTCAGTGTCGG