Homologs in group_3296

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09530 FBDBKF_09530 100.0 Morganella morganii S1 - tRNA-dihydrouridine synthase C
EHELCC_04330 EHELCC_04330 100.0 Morganella morganii S2 - tRNA-dihydrouridine synthase C
NLDBIP_04330 NLDBIP_04330 100.0 Morganella morganii S4 - tRNA-dihydrouridine synthase C
LHKJJB_14300 LHKJJB_14300 100.0 Morganella morganii S3 - tRNA-dihydrouridine synthase C

Distribution of the homologs in the orthogroup group_3296

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3296

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P44606 2.93e-54 174 80 0 97 3 dusC tRNA-dihydrouridine(16) synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CJW1 1.69e-51 167 79 0 97 3 dusC tRNA-dihydrouridine(16) synthase Pasteurella multocida (strain Pm70)
Q8ZNM4 6.75e-51 165 80 0 97 3 dusC tRNA-dihydrouridine(16) synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q7VKU5 4.55e-50 163 72 0 96 3 dusC tRNA-dihydrouridine(16) synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8XEC6 1.37e-49 162 81 0 97 3 dusC tRNA-dihydrouridine(16) synthase Escherichia coli O157:H7
Q8FFV5 1.51e-49 162 81 0 97 3 dusC tRNA-dihydrouridine(16) synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P33371 1.68e-49 162 81 0 97 1 dusC tRNA-dihydrouridine(16) synthase Escherichia coli (strain K12)
Q8Z5B2 9.25e-49 159 80 0 97 3 dusC tRNA-dihydrouridine(16) synthase Salmonella typhi
Q8ZGV2 1.64e-48 159 77 0 97 3 dusC tRNA-dihydrouridine(16) synthase Yersinia pestis
Q7UC91 2.06e-48 159 80 0 97 3 dusC tRNA-dihydrouridine(16) synthase Shigella flexneri
Q8DAH1 8.41e-44 147 63 0 97 3 dusC tRNA-dihydrouridine(16) synthase Vibrio vulnificus (strain CMCP6)
Q87N01 1.39e-43 147 65 0 97 3 dusC tRNA-dihydrouridine(16) synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8EFG7 7.19e-43 144 69 0 97 3 dusC tRNA-dihydrouridine(16) synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q9KT00 8.03e-43 145 65 0 97 3 dusC tRNA-dihydrouridine(16) synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8XYX1 9.66e-32 116 57 0 96 3 dusC tRNA-dihydrouridine(16) synthase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
O68273 1.19e-28 108 54 0 96 3 dusC tRNA-dihydrouridine(16) synthase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q9HZ95 2.02e-27 104 51 0 97 3 dusC tRNA-dihydrouridine(16) synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q88LF2 3.92e-26 101 52 0 97 3 dusC tRNA-dihydrouridine(16) synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9AMN9 8.29e-26 100 49 0 97 3 dusC tRNA-dihydrouridine(16) synthase Pseudomonas alcaligenes
Q884C6 1.82e-25 99 49 0 97 3 dusC tRNA-dihydrouridine(16) synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q9JZL5 4.62e-22 90 42 0 96 3 dusC tRNA-dihydrouridine(16) synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JUP6 2.97e-21 88 42 0 96 3 dusC tRNA-dihydrouridine(16) synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P96192 4.26e-21 87 57 0 97 3 dusC tRNA-dihydrouridine(16) synthase Azotobacter vinelandii
Q6GKK9 1.87e-05 45 30 2 96 3 dus Probable tRNA-dihydrouridine synthase Staphylococcus aureus (strain MRSA252)
Q8NYV4 1.89e-05 45 30 2 96 3 dus Probable tRNA-dihydrouridine synthase Staphylococcus aureus (strain MW2)
Q6GD38 1.89e-05 45 30 2 96 3 dus Probable tRNA-dihydrouridine synthase Staphylococcus aureus (strain MSSA476)
Q5HJT5 1.89e-05 45 30 2 96 3 dus Probable tRNA-dihydrouridine synthase Staphylococcus aureus (strain COL)
P67717 2.66e-05 44 30 2 96 1 dus Probable tRNA-dihydrouridine synthase Staphylococcus aureus (strain N315)
P67716 2.66e-05 44 30 2 96 3 dus Probable tRNA-dihydrouridine synthase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q55724 0.0002 42 30 2 96 3 dus1 Probable tRNA-dihydrouridine synthase 1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q5HKD5 0.000368 41 30 2 96 3 dus Probable tRNA-dihydrouridine synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_12235
Feature type CDS
Gene -
Product tRNA-dihydrouridine synthase C
Location 5261 - 5569 (strand: -1)
Length 309 (nucleotides) / 102 (amino acids)

Contig

Accession ZDB_690
Length 144397 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3296
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF01207 Dihydrouridine synthase (Dus)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0042 Translation, ribosomal structure and biogenesis (J) J tRNA-dihydrouridine synthase

Protein Sequence

MRVLLAPMQGVLDPLVRHLLTAVNDYDLCITEFVRVVDMLLPEKLFFRLCPELENGGLTESGTPVRIQLLGQFPQWLAENAARAAELGSHGVDLNCGWTKFM

Flanking regions ( +/- flanking 50bp)

GCGACTCCGGCAGCCCGTGGGGTAACCGGGGCAAATAACGGAACCGGCTCATGCGTGTTCTTTTAGCACCAATGCAGGGGGTCTTAGACCCCCTCGTCCGTCATCTGCTGACGGCGGTGAATGACTATGATCTCTGTATCACCGAGTTTGTCCGTGTGGTGGATATGCTGCTGCCGGAGAAACTGTTTTTCCGTCTCTGTCCGGAGCTGGAAAACGGCGGTCTGACCGAATCCGGTACGCCGGTGCGGATCCAACTGCTGGGGCAGTTCCCGCAATGGCTGGCGGAAAATGCCGCACGTGCGGCGGAACTCGGCTCGCACGGGGTGGATCTCAACTGCGGCTGGACAAAGTTTATGTAGGATAAACACAATTAATTGAACCAATTGATTAAATATACTTATGCATATAT