Homologs in group_1373

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08495 FBDBKF_08495 100.0 Morganella morganii S1 rpsF 30S ribosomal protein S6
EHELCC_13030 EHELCC_13030 100.0 Morganella morganii S2 rpsF 30S ribosomal protein S6
NLDBIP_13370 NLDBIP_13370 100.0 Morganella morganii S4 rpsF 30S ribosomal protein S6
LHKJJB_13185 LHKJJB_13185 100.0 Morganella morganii S3 rpsF 30S ribosomal protein S6
F4V73_RS09715 F4V73_RS09715 100.0 Morganella psychrotolerans rpsF 30S ribosomal protein S6
PMI_RS16790 PMI_RS16790 85.9 Proteus mirabilis HI4320 rpsF 30S ribosomal protein S6

Distribution of the homologs in the orthogroup group_1373

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1373

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7MYU7 4.95e-75 221 83 1 131 3 rpsF Small ribosomal subunit protein bS6 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P66593 1.08e-74 221 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66594 1.08e-74 221 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Salmonella typhi
B4TT33 1.08e-74 221 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Salmonella schwarzengrund (strain CVM19633)
B5BKK9 1.08e-74 221 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Salmonella paratyphi A (strain AKU_12601)
C0Q6F8 1.08e-74 221 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Salmonella paratyphi C (strain RKS4594)
A9N518 1.08e-74 221 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PJ58 1.08e-74 221 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T3F1 1.08e-74 221 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Salmonella newport (strain SL254)
B4TFD5 1.08e-74 221 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Salmonella heidelberg (strain SL476)
B5R9E8 1.08e-74 221 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R0R8 1.08e-74 221 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Salmonella enteritidis PT4 (strain P125109)
Q57GJ1 1.08e-74 221 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Salmonella choleraesuis (strain SC-B67)
B5F3B7 1.08e-74 221 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Salmonella agona (strain SL483)
A7MM76 1.08e-74 221 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Cronobacter sakazakii (strain ATCC BAA-894)
B7NGD4 1.28e-74 220 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B5FSA1 1.3e-74 220 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Salmonella dublin (strain CT_02021853)
Q3YUE7 1.39e-74 220 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Shigella sonnei (strain Ss046)
P0A4D2 1.39e-74 220 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Shigella flexneri
Q0SX85 1.39e-74 220 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Shigella flexneri serotype 5b (strain 8401)
Q328J9 1.39e-74 220 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Shigella dysenteriae serotype 1 (strain Sd197)
Q31TD1 1.39e-74 220 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Shigella boydii serotype 4 (strain Sb227)
B2TY73 1.39e-74 220 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LLY2 1.39e-74 220 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R360 1.39e-74 220 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Escherichia coli (strain UTI89 / UPEC)
B1LQM0 1.39e-74 220 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Escherichia coli (strain SMS-3-5 / SECEC)
B6I2A6 1.39e-74 220 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Escherichia coli (strain SE11)
B1IT06 1.39e-74 220 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A4D0 1.39e-74 220 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1AJA5 1.39e-74 220 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Escherichia coli O1:K1 / APEC
A8A7U6 1.39e-74 220 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Escherichia coli O9:H4 (strain HS)
B1XDV1 1.39e-74 220 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Escherichia coli (strain K12 / DH10B)
C4ZR77 1.39e-74 220 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M9G2 1.39e-74 220 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Escherichia coli O8 (strain IAI1)
B7MST0 1.39e-74 220 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Escherichia coli O81 (strain ED1a)
B7NTQ6 1.39e-74 220 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z2K6 1.39e-74 220 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A4D1 1.39e-74 220 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Escherichia coli O157:H7
B7LCQ6 1.39e-74 220 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Escherichia coli (strain 55989 / EAEC)
B7MLK5 1.39e-74 220 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UQK9 1.39e-74 220 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZV71 1.39e-74 220 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Escherichia coli O139:H28 (strain E24377A / ETEC)
Q2NW55 1.64e-74 220 80 1 131 3 rpsF Small ribosomal subunit protein bS6 Sodalis glossinidius (strain morsitans)
A9MFL1 1.65e-74 220 80 1 131 3 rpsF Small ribosomal subunit protein bS6 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B1JMM4 5.71e-74 219 82 1 130 3 rpsF Small ribosomal subunit protein bS6 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FA2 5.71e-74 219 82 1 130 3 rpsF Small ribosomal subunit protein bS6 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CEH0 5.71e-74 219 82 1 130 3 rpsF Small ribosomal subunit protein bS6 Yersinia pestis bv. Antiqua (strain Nepal516)
A9QYL5 5.71e-74 219 82 1 130 3 rpsF Small ribosomal subunit protein bS6 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZB81 5.71e-74 219 82 1 130 3 rpsF Small ribosomal subunit protein bS6 Yersinia pestis
B2K2L3 5.71e-74 219 82 1 130 3 rpsF Small ribosomal subunit protein bS6 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CBW4 5.71e-74 219 82 1 130 3 rpsF Small ribosomal subunit protein bS6 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FMW5 5.71e-74 219 82 1 130 3 rpsF Small ribosomal subunit protein bS6 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JIS8 5.71e-74 219 82 1 130 3 rpsF Small ribosomal subunit protein bS6 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8AMJ8 6.37e-74 219 81 1 131 3 rpsF Small ribosomal subunit protein bS6 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P02358 2.35e-73 217 81 1 129 1 rpsF Small ribosomal subunit protein bS6 Escherichia coli (strain K12)
B2VCW1 2.57e-73 217 80 1 131 3 rpsF Small ribosomal subunit protein bS6 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A4TRM5 3.09e-73 217 81 1 130 3 rpsF Small ribosomal subunit protein bS6 Yersinia pestis (strain Pestoides F)
A8G8W4 3.53e-73 217 80 1 132 3 rpsF Small ribosomal subunit protein bS6 Serratia proteamaculans (strain 568)
B4F275 3.69e-73 217 89 1 115 3 rpsF Small ribosomal subunit protein bS6 Proteus mirabilis (strain HI4320)
B5Y307 8.4e-73 216 80 1 131 3 rpsF Small ribosomal subunit protein bS6 Klebsiella pneumoniae (strain 342)
Q6D135 9.17e-73 216 81 1 130 3 rpsF Small ribosomal subunit protein bS6 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C5BF77 1.59e-72 215 80 1 131 3 rpsF Small ribosomal subunit protein bS6 Edwardsiella ictaluri (strain 93-146)
A6THB1 2.16e-72 215 80 1 131 3 rpsF Small ribosomal subunit protein bS6 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
C6DE15 2.84e-72 214 80 1 130 3 rpsF Small ribosomal subunit protein bS6 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A4W5S9 4.12e-72 214 80 1 131 3 rpsF Small ribosomal subunit protein bS6 Enterobacter sp. (strain 638)
Q65VD4 5.15e-68 203 78 1 122 3 rpsF Small ribosomal subunit protein bS6 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q0I4E5 5.82e-67 201 77 1 122 3 rpsF Small ribosomal subunit protein bS6 Histophilus somni (strain 129Pt)
B0US43 2.19e-66 199 76 1 122 3 rpsF Small ribosomal subunit protein bS6 Histophilus somni (strain 2336)
A6VMD6 8.09e-66 198 81 0 110 3 rpsF Small ribosomal subunit protein bS6 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q9CLN8 1.05e-65 197 74 2 128 3 rpsF Small ribosomal subunit protein bS6 Pasteurella multocida (strain Pm70)
A4SIZ7 6.07e-65 196 75 0 129 3 rpsF Small ribosomal subunit protein bS6 Aeromonas salmonicida (strain A449)
P44375 1.34e-64 195 74 1 122 3 rpsF Small ribosomal subunit protein bS6 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UH52 1.34e-64 195 74 1 122 3 rpsF Small ribosomal subunit protein bS6 Haemophilus influenzae (strain PittGG)
Q4QN01 1.34e-64 195 74 1 122 3 rpsF Small ribosomal subunit protein bS6 Haemophilus influenzae (strain 86-028NP)
A0KG67 7.01e-64 193 82 0 112 3 rpsF Small ribosomal subunit protein bS6 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A5U9U8 8.84e-64 193 73 1 122 3 rpsF Small ribosomal subunit protein bS6 Haemophilus influenzae (strain PittEE)
A8FR95 1.47e-63 192 71 0 129 3 rpsF Small ribosomal subunit protein bS6 Shewanella sediminis (strain HAW-EB3)
Q8EAH2 1.72e-63 192 73 0 128 3 rpsF Small ribosomal subunit protein bS6 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B8F5T7 2.64e-63 192 80 0 110 3 rpsF Small ribosomal subunit protein bS6 Glaesserella parasuis serovar 5 (strain SH0165)
A0KT20 2.75e-63 192 74 0 128 3 rpsF Small ribosomal subunit protein bS6 Shewanella sp. (strain ANA-3)
A1SA60 3.58e-63 192 71 1 131 3 rpsF Small ribosomal subunit protein bS6 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B1KHZ0 3.61e-63 192 71 0 129 3 rpsF Small ribosomal subunit protein bS6 Shewanella woodyi (strain ATCC 51908 / MS32)
Q6LM41 4.83e-63 192 71 1 127 3 rpsF Small ribosomal subunit protein bS6 Photobacterium profundum (strain SS9)
C3LR98 7.6e-63 190 77 0 113 3 rpsF Small ribosomal subunit protein bS6 Vibrio cholerae serotype O1 (strain M66-2)
Q9KUZ2 7.6e-63 190 77 0 113 3 rpsF Small ribosomal subunit protein bS6 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F3K3 7.6e-63 190 77 0 113 3 rpsF Small ribosomal subunit protein bS6 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q0HYW6 1.9e-62 189 73 0 128 3 rpsF Small ribosomal subunit protein bS6 Shewanella sp. (strain MR-7)
Q0HF39 1.9e-62 189 73 0 128 3 rpsF Small ribosomal subunit protein bS6 Shewanella sp. (strain MR-4)
Q07XS7 2.85e-62 189 73 1 130 3 rpsF Small ribosomal subunit protein bS6 Shewanella frigidimarina (strain NCIMB 400)
Q7MH88 3.37e-62 189 78 0 112 3 rpsF Small ribosomal subunit protein bS6 Vibrio vulnificus (strain YJ016)
Q8DCL6 3.37e-62 189 78 0 112 3 rpsF Small ribosomal subunit protein bS6 Vibrio vulnificus (strain CMCP6)
C4LAB8 4.84e-62 188 81 1 112 3 rpsF Small ribosomal subunit protein bS6 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A3QI52 4.96e-62 189 75 0 117 3 rpsF Small ribosomal subunit protein bS6 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
C4K434 6.64e-62 189 77 0 110 3 rpsF Small ribosomal subunit protein bS6 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B8CIQ1 6.67e-62 188 72 1 129 3 rpsF Small ribosomal subunit protein bS6 Shewanella piezotolerans (strain WP3 / JCM 13877)
A7MSX8 1.54e-61 187 78 0 112 3 rpsF Small ribosomal subunit protein bS6 Vibrio campbellii (strain ATCC BAA-1116)
B0BQB3 2.51e-61 186 77 0 109 3 rpsF Small ribosomal subunit protein bS6 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GY59 2.51e-61 186 77 0 109 3 rpsF Small ribosomal subunit protein bS6 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B0TUU9 2.51e-61 187 76 0 115 3 rpsF Small ribosomal subunit protein bS6 Shewanella halifaxensis (strain HAW-EB4)
Q489U1 3.51e-61 187 79 0 110 3 rpsF Small ribosomal subunit protein bS6 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A3N1H3 3.89e-61 186 77 0 109 3 rpsF Small ribosomal subunit protein bS6 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A1RNI9 4.46e-61 186 73 0 124 3 rpsF Small ribosomal subunit protein bS6 Shewanella sp. (strain W3-18-1)
A4Y3F0 4.46e-61 186 73 0 124 3 rpsF Small ribosomal subunit protein bS6 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
B5FBQ3 4.57e-61 186 75 0 112 3 rpsF Small ribosomal subunit protein bS6 Aliivibrio fischeri (strain MJ11)
Q5E2D9 4.57e-61 186 75 0 112 3 rpsF Small ribosomal subunit protein bS6 Aliivibrio fischeri (strain ATCC 700601 / ES114)
A8H8L2 7.68e-61 186 74 0 117 3 rpsF Small ribosomal subunit protein bS6 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B7VI65 1.48e-60 185 77 0 112 3 rpsF Small ribosomal subunit protein bS6 Vibrio atlanticus (strain LGP32)
B6EMP6 2.42e-60 184 75 0 112 3 rpsF Small ribosomal subunit protein bS6 Aliivibrio salmonicida (strain LFI1238)
Q12RW9 2.84e-60 184 76 0 117 3 rpsF Small ribosomal subunit protein bS6 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q5QY01 2.94e-60 184 74 0 110 3 rpsF Small ribosomal subunit protein bS6 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A9L120 5.43e-60 183 78 0 112 3 rpsF Small ribosomal subunit protein bS6 Shewanella baltica (strain OS195)
A6WJ79 5.43e-60 183 78 0 112 3 rpsF Small ribosomal subunit protein bS6 Shewanella baltica (strain OS185)
A3D8Q5 5.43e-60 183 78 0 112 3 rpsF Small ribosomal subunit protein bS6 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E9N6 5.43e-60 183 78 0 112 3 rpsF Small ribosomal subunit protein bS6 Shewanella baltica (strain OS223)
Q1LSR2 1.09e-59 182 68 0 122 3 rpsF Small ribosomal subunit protein bS6 Baumannia cicadellinicola subsp. Homalodisca coagulata
Q7VMD7 1.51e-59 182 68 1 125 3 rpsF Small ribosomal subunit protein bS6 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q3IIA2 3.09e-59 181 75 0 111 3 rpsF Small ribosomal subunit protein bS6 Pseudoalteromonas translucida (strain TAC 125)
Q87L72 5.67e-59 181 79 0 106 3 rpsF Small ribosomal subunit protein bS6 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
O07813 5.46e-58 178 74 1 110 3 rpsF Small ribosomal subunit protein bS6 Neisseria gonorrhoeae
Q5F925 5.46e-58 178 74 1 110 3 rpsF Small ribosomal subunit protein bS6 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B4S012 1.27e-57 177 72 0 115 3 rpsF Small ribosomal subunit protein bS6 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
A1KUF0 2.04e-57 177 73 1 110 3 rpsF Small ribosomal subunit protein bS6 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JU24 2.04e-57 177 73 1 110 3 rpsF Small ribosomal subunit protein bS6 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9LZQ3 2.04e-57 177 73 1 110 3 rpsF Small ribosomal subunit protein bS6 Neisseria meningitidis serogroup C (strain 053442)
Q9JZ29 3.56e-57 176 72 1 110 3 rpsF Small ribosomal subunit protein bS6 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A1T038 3.84e-57 176 75 0 109 3 rpsF Small ribosomal subunit protein bS6 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q1QZ63 8.33e-56 173 69 1 112 3 rpsF Small ribosomal subunit protein bS6 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A1WUS7 1.85e-55 171 65 0 119 3 rpsF Small ribosomal subunit protein bS6 Halorhodospira halophila (strain DSM 244 / SL1)
B0V7G7 2.33e-54 169 64 0 112 3 rpsF Small ribosomal subunit protein bS6 Acinetobacter baumannii (strain AYE)
A3M6Q4 2.33e-54 169 64 0 112 3 rpsF Small ribosomal subunit protein bS6 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VM10 2.33e-54 169 64 0 112 3 rpsF Small ribosomal subunit protein bS6 Acinetobacter baumannii (strain SDF)
B7IBC1 2.33e-54 169 64 0 112 1 rpsF Small ribosomal subunit protein bS6 Acinetobacter baumannii (strain AB0057)
B7H0K0 2.33e-54 169 64 0 112 3 rpsF Small ribosomal subunit protein bS6 Acinetobacter baumannii (strain AB307-0294)
Q606H8 1.34e-53 167 66 1 117 3 rpsF Small ribosomal subunit protein bS6 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q1H1P3 1.92e-53 167 67 1 116 3 rpsF Small ribosomal subunit protein bS6 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A1K3D0 1.99e-53 167 61 0 127 3 rpsF Small ribosomal subunit protein bS6 Azoarcus sp. (strain BH72)
Q0AB51 2.77e-53 166 68 0 108 3 rpsF Small ribosomal subunit protein bS6 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
C5BN45 3.93e-53 167 64 0 112 3 rpsF Small ribosomal subunit protein bS6 Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q5P2M5 5.1e-53 166 67 0 109 3 rpsF Small ribosomal subunit protein bS6 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q21LW0 6.64e-53 166 65 0 108 3 rpsF Small ribosomal subunit protein bS6 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q0VMF9 1.05e-52 164 68 0 104 3 rpsF Small ribosomal subunit protein bS6 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A1U393 1.63e-52 165 61 3 138 3 rpsF Small ribosomal subunit protein bS6 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A6W0Y9 5.33e-52 163 59 2 134 3 rpsF Small ribosomal subunit protein bS6 Marinomonas sp. (strain MWYL1)
B8GNS2 1.08e-51 162 69 0 108 3 rpsF Small ribosomal subunit protein bS6 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q2SLB5 1.43e-51 162 64 1 114 3 rpsF Small ribosomal subunit protein bS6 Hahella chejuensis (strain KCTC 2396)
Q82XQ6 5.28e-51 161 58 0 125 3 rpsF Small ribosomal subunit protein bS6 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B2JG18 6.57e-51 160 70 0 104 3 rpsF Small ribosomal subunit protein bS6 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q13ZH2 7.02e-51 160 69 0 104 3 rpsF Small ribosomal subunit protein bS6 Paraburkholderia xenovorans (strain LB400)
B2T3N3 7.02e-51 160 69 0 104 3 rpsF Small ribosomal subunit protein bS6 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A9AJW1 8.64e-51 160 70 0 104 3 rpsF Small ribosomal subunit protein bS6 Burkholderia multivorans (strain ATCC 17616 / 249)
Q39FJ8 8.64e-51 160 70 0 104 3 rpsF Small ribosomal subunit protein bS6 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q7NRY7 9.33e-51 160 68 0 104 3 rpsF Small ribosomal subunit protein bS6 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A9ITA2 1.11e-50 160 57 0 125 3 rpsF Small ribosomal subunit protein bS6 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A4JEV1 1.12e-50 160 70 0 104 3 rpsF Small ribosomal subunit protein bS6 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q0BEQ6 1.12e-50 160 70 0 104 3 rpsF Small ribosomal subunit protein bS6 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YRJ4 1.12e-50 160 70 0 104 3 rpsF Small ribosomal subunit protein bS6 Burkholderia ambifaria (strain MC40-6)
Q1BH36 1.34e-50 159 70 0 104 3 rpsF Small ribosomal subunit protein bS6 Burkholderia orbicola (strain AU 1054)
A0K7Z8 1.34e-50 159 70 0 104 3 rpsF Small ribosomal subunit protein bS6 Burkholderia cenocepacia (strain HI2424)
Q31FW4 1.38e-50 159 63 0 113 3 rpsF Small ribosomal subunit protein bS6 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
B4SP94 1.5e-50 160 69 0 108 3 rpsF Small ribosomal subunit protein bS6 Stenotrophomonas maltophilia (strain R551-3)
Q2SWJ9 2.76e-50 159 69 0 104 3 rpsF Small ribosomal subunit protein bS6 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63UY6 2.76e-50 159 69 0 104 3 rpsF Small ribosomal subunit protein bS6 Burkholderia pseudomallei (strain K96243)
A3NAB6 2.76e-50 159 69 0 104 3 rpsF Small ribosomal subunit protein bS6 Burkholderia pseudomallei (strain 668)
Q3JRJ2 2.76e-50 159 69 0 104 3 rpsF Small ribosomal subunit protein bS6 Burkholderia pseudomallei (strain 1710b)
A3NW34 2.76e-50 159 69 0 104 3 rpsF Small ribosomal subunit protein bS6 Burkholderia pseudomallei (strain 1106a)
A1V4R1 2.76e-50 159 69 0 104 3 rpsF Small ribosomal subunit protein bS6 Burkholderia mallei (strain SAVP1)
Q62JQ9 2.76e-50 159 69 0 104 3 rpsF Small ribosomal subunit protein bS6 Burkholderia mallei (strain ATCC 23344)
A2S242 2.76e-50 159 69 0 104 3 rpsF Small ribosomal subunit protein bS6 Burkholderia mallei (strain NCTC 10229)
A3MKD6 2.76e-50 159 69 0 104 3 rpsF Small ribosomal subunit protein bS6 Burkholderia mallei (strain NCTC 10247)
B1JTF3 3.32e-50 158 69 0 104 3 rpsF Small ribosomal subunit protein bS6 Burkholderia orbicola (strain MC0-3)
B4EBH3 3.32e-50 158 69 0 104 3 rpsF Small ribosomal subunit protein bS6 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
B2UAG4 5.7e-50 158 67 0 104 3 rpsF Small ribosomal subunit protein bS6 Ralstonia pickettii (strain 12J)
C1DCR4 5.93e-50 158 65 0 104 3 rpsF Small ribosomal subunit protein bS6 Laribacter hongkongensis (strain HLHK9)
Q4FS21 6.54e-50 158 63 0 112 3 rpsF Small ribosomal subunit protein bS6 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q0ADI6 7.32e-50 158 62 1 115 3 rpsF Small ribosomal subunit protein bS6 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q47GQ9 7.69e-50 157 65 0 104 3 rpsF Small ribosomal subunit protein bS6 Dechloromonas aromatica (strain RCB)
Q8XZT8 7.75e-50 157 66 0 104 3 rpsF Small ribosomal subunit protein bS6 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B3PCS2 1.25e-49 158 55 2 145 3 rpsF Small ribosomal subunit protein bS6 Cellvibrio japonicus (strain Ueda107)
Q46ZR3 1.35e-49 157 57 0 124 3 rpsF Small ribosomal subunit protein bS6 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q6F9R0 1.42e-49 157 64 0 112 3 rpsF Small ribosomal subunit protein bS6 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q1QBZ0 1.9e-49 157 63 0 112 3 rpsF Small ribosomal subunit protein bS6 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
A5WFY9 2.15e-49 157 60 0 112 3 rpsF Small ribosomal subunit protein bS6 Psychrobacter sp. (strain PRwf-1)
Q3SH31 2.62e-49 156 58 1 126 3 rpsF Small ribosomal subunit protein bS6 Thiobacillus denitrificans (strain ATCC 25259)
Q2Y7M5 3.42e-49 156 63 1 114 3 rpsF Small ribosomal subunit protein bS6 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q1LLW8 5.79e-49 155 58 0 124 3 rpsF Small ribosomal subunit protein bS6 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A9KFL5 7.51e-49 155 58 0 111 3 rpsF Small ribosomal subunit protein bS6 Coxiella burnetii (strain Dugway 5J108-111)
B3R2P7 8.88e-49 155 57 0 124 3 rpsF Small ribosomal subunit protein bS6 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0K9E5 8.88e-49 155 57 0 124 3 rpsF Small ribosomal subunit protein bS6 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q83D76 1.12e-48 155 58 0 111 3 rpsF Small ribosomal subunit protein bS6 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9ND53 1.12e-48 155 58 0 111 3 rpsF Small ribosomal subunit protein bS6 Coxiella burnetii (strain RSA 331 / Henzerling II)
B6J0J6 1.12e-48 155 58 0 111 3 rpsF Small ribosomal subunit protein bS6 Coxiella burnetii (strain CbuG_Q212)
Q493V5 1.13e-48 154 60 0 110 3 rpsF Small ribosomal subunit protein bS6 Blochmanniella pennsylvanica (strain BPEN)
B6J6T7 1.34e-48 154 58 1 116 3 rpsF Small ribosomal subunit protein bS6 Coxiella burnetii (strain CbuK_Q154)
Q9HUM9 2.73e-48 154 68 0 105 1 rpsF Small ribosomal subunit protein bS6 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02F83 2.73e-48 154 68 0 105 3 rpsF Small ribosomal subunit protein bS6 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V1Z8 2.73e-48 154 68 0 105 3 rpsF Small ribosomal subunit protein bS6 Pseudomonas aeruginosa (strain LESB58)
A6VD48 2.73e-48 154 68 0 105 3 rpsF Small ribosomal subunit protein bS6 Pseudomonas aeruginosa (strain PA7)
A4SVX6 3.94e-48 153 60 1 118 3 rpsF Small ribosomal subunit protein bS6 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q3JEJ6 6.35e-48 154 62 0 107 3 rpsF Small ribosomal subunit protein bS6 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A6SXJ4 6.54e-48 152 66 0 105 3 rpsF Small ribosomal subunit protein bS6 Janthinobacterium sp. (strain Marseille)
A4G712 8.23e-48 152 65 0 105 3 rpsF Small ribosomal subunit protein bS6 Herminiimonas arsenicoxydans
Q3BV21 8.28e-48 153 66 0 108 3 rpsF Small ribosomal subunit protein bS6 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PM14 8.28e-48 153 66 0 108 3 rpsF Small ribosomal subunit protein bS6 Xanthomonas axonopodis pv. citri (strain 306)
Q7VV89 1.24e-47 152 63 0 105 3 rpsF Small ribosomal subunit protein bS6 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W7P8 1.24e-47 152 63 0 105 3 rpsF Small ribosomal subunit protein bS6 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WL35 1.24e-47 152 63 0 105 3 rpsF Small ribosomal subunit protein bS6 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q89A41 1.61e-47 151 57 0 109 3 rpsF Small ribosomal subunit protein bS6 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
C5CUP0 3.97e-47 150 63 0 104 3 rpsF Small ribosomal subunit protein bS6 Variovorax paradoxus (strain S110)
B1XTM5 4.38e-47 150 63 0 104 3 rpsF Small ribosomal subunit protein bS6 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A4VQN0 5.86e-47 150 64 0 105 3 rpsF Small ribosomal subunit protein bS6 Stutzerimonas stutzeri (strain A1501)
Q8K918 6.21e-47 150 65 0 103 3 rpsF Small ribosomal subunit protein bS6 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q8PAC2 6.46e-47 151 65 0 108 3 rpsF Small ribosomal subunit protein bS6 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UTA3 6.46e-47 151 65 0 108 3 rpsF Small ribosomal subunit protein bS6 Xanthomonas campestris pv. campestris (strain 8004)
B5EPA0 6.73e-47 150 61 0 112 3 rpsF Small ribosomal subunit protein bS6 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J917 6.73e-47 150 61 0 112 3 rpsF Small ribosomal subunit protein bS6 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
A9BNG3 6.84e-47 150 60 0 115 3 rpsF Small ribosomal subunit protein bS6 Delftia acidovorans (strain DSM 14801 / SPH-1)
B0RUY9 6.9e-47 150 65 0 108 3 rpsF Small ribosomal subunit protein bS6 Xanthomonas campestris pv. campestris (strain B100)
Q5H051 7.07e-47 150 65 0 108 3 rpsF Small ribosomal subunit protein bS6 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SIV0 7.07e-47 150 65 0 108 3 rpsF Small ribosomal subunit protein bS6 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P328 7.07e-47 150 65 0 108 3 rpsF Small ribosomal subunit protein bS6 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q1I461 7.74e-47 150 65 0 105 3 rpsF Small ribosomal subunit protein bS6 Pseudomonas entomophila (strain L48)
B1XXH5 1.47e-46 149 59 0 115 3 rpsF Small ribosomal subunit protein bS6 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A5EXN1 1.72e-46 149 63 0 104 3 rpsF Small ribosomal subunit protein bS6 Dichelobacter nodosus (strain VCS1703A)
A2SFZ9 1.93e-46 149 63 0 105 3 rpsF Small ribosomal subunit protein bS6 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A1WAR4 2e-46 149 59 0 115 3 rpsF Small ribosomal subunit protein bS6 Acidovorax sp. (strain JS42)
B9MDJ5 2e-46 149 59 0 115 3 rpsF Small ribosomal subunit protein bS6 Acidovorax ebreus (strain TPSY)
Q2KZ18 2.05e-46 149 62 0 105 3 rpsF Small ribosomal subunit protein bS6 Bordetella avium (strain 197N)
A1WGK1 2.34e-46 149 63 0 104 3 rpsF Small ribosomal subunit protein bS6 Verminephrobacter eiseniae (strain EF01-2)
C1DLR2 2.44e-46 149 63 0 105 3 rpsF Small ribosomal subunit protein bS6 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q4ZYX1 6.47e-46 148 64 0 105 3 rpsF Small ribosomal subunit protein bS6 Pseudomonas syringae pv. syringae (strain B728a)
Q87VK3 6.47e-46 148 64 0 105 3 rpsF Small ribosomal subunit protein bS6 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48NZ3 6.47e-46 148 64 0 105 3 rpsF Small ribosomal subunit protein bS6 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
C3KE67 6.62e-46 148 64 0 105 3 rpsF Small ribosomal subunit protein bS6 Pseudomonas fluorescens (strain SBW25)
B1JAH1 6.75e-46 148 64 0 105 3 rpsF Small ribosomal subunit protein bS6 Pseudomonas putida (strain W619)
Q88DE8 6.75e-46 148 64 0 105 3 rpsF Small ribosomal subunit protein bS6 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KKY3 6.75e-46 148 64 0 105 3 rpsF Small ribosomal subunit protein bS6 Pseudomonas putida (strain GB-1)
A5W9R8 6.75e-46 148 64 0 105 3 rpsF Small ribosomal subunit protein bS6 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B0U5H2 9.34e-46 148 59 1 118 3 rpsF Small ribosomal subunit protein bS6 Xylella fastidiosa (strain M12)
A1TLI1 1.3e-45 147 59 0 115 3 rpsF Small ribosomal subunit protein bS6 Paracidovorax citrulli (strain AAC00-1)
Q3KIX8 1.43e-45 147 64 0 105 3 rpsF Small ribosomal subunit protein bS6 Pseudomonas fluorescens (strain Pf0-1)
Q4KJ62 1.64e-45 147 63 0 105 3 rpsF Small ribosomal subunit protein bS6 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q21WD6 1.8e-45 146 63 0 104 3 rpsF Small ribosomal subunit protein bS6 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
P66605 1.94e-45 147 59 1 118 3 rpsF Small ribosomal subunit protein bS6 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P66604 1.94e-45 147 59 1 118 3 rpsF Small ribosomal subunit protein bS6 Xylella fastidiosa (strain 9a5c)
B2I9S9 1.94e-45 147 59 1 118 3 rpsF Small ribosomal subunit protein bS6 Xylella fastidiosa (strain M23)
A4XPZ7 6.58e-45 145 64 0 104 3 rpsF Small ribosomal subunit protein bS6 Pseudomonas mendocina (strain ymp)
B8D885 2.27e-44 143 60 0 102 3 rpsF Small ribosomal subunit protein bS6 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57627 2.27e-44 143 60 0 102 3 rpsF Small ribosomal subunit protein bS6 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8C8 2.27e-44 143 60 0 102 3 rpsF Small ribosomal subunit protein bS6 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q128U1 1.18e-43 142 60 0 104 3 rpsF Small ribosomal subunit protein bS6 Polaromonas sp. (strain JS666 / ATCC BAA-500)
A4IY07 1.19e-43 141 54 0 108 3 rpsF Small ribosomal subunit protein bS6 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NFZ9 1.19e-43 141 54 0 108 3 rpsF Small ribosomal subunit protein bS6 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
A0Q6H4 1.19e-43 141 54 0 108 3 rpsF Small ribosomal subunit protein bS6 Francisella tularensis subsp. novicida (strain U112)
B2SGH0 1.19e-43 141 54 0 108 3 rpsF Small ribosomal subunit protein bS6 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A3H7 1.19e-43 141 54 0 108 3 rpsF Small ribosomal subunit protein bS6 Francisella tularensis subsp. holarctica (strain LVS)
Q14HF1 1.19e-43 141 54 0 108 3 rpsF Small ribosomal subunit protein bS6 Francisella tularensis subsp. tularensis (strain FSC 198)
A1AWU9 1.84e-43 141 53 0 112 3 rpsF Small ribosomal subunit protein bS6 Ruthia magnifica subsp. Calyptogena magnifica
A1VPX4 2.43e-43 141 60 0 104 3 rpsF Small ribosomal subunit protein bS6 Polaromonas naphthalenivorans (strain CJ2)
Q5WWM0 3.72e-43 140 55 0 110 3 rpsF Small ribosomal subunit protein bS6 Legionella pneumophila (strain Lens)
Q5ZV48 3.72e-43 140 55 0 110 3 rpsF Small ribosomal subunit protein bS6 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IC90 3.72e-43 140 55 0 110 3 rpsF Small ribosomal subunit protein bS6 Legionella pneumophila (strain Corby)
Q5X4X0 3.72e-43 140 55 0 110 3 rpsF Small ribosomal subunit protein bS6 Legionella pneumophila (strain Paris)
Q8D2U2 7.72e-43 139 55 0 109 3 rpsF Small ribosomal subunit protein bS6 Wigglesworthia glossinidia brevipalpis
B0U079 1.71e-42 139 57 0 108 3 rpsF Small ribosomal subunit protein bS6 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A5CWD9 4.24e-41 135 50 0 112 3 rpsF Small ribosomal subunit protein bS6 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q7VQN9 6.85e-40 132 49 0 108 3 rpsF Small ribosomal subunit protein bS6 Blochmanniella floridana
Q056X8 7.36e-31 109 43 0 110 3 rpsF Small ribosomal subunit protein bS6 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q0AQD2 1.27e-23 91 41 1 113 3 rpsF Small ribosomal subunit protein bS6 Maricaulis maris (strain MCS10)
A0PX87 6.79e-22 86 42 1 91 3 rpsF Small ribosomal subunit protein bS6 Clostridium novyi (strain NT)
C0ZA47 4.05e-21 84 40 1 92 3 rpsF Small ribosomal subunit protein bS6 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
B8IED2 8.8e-21 84 39 1 108 3 rpsF Small ribosomal subunit protein bS6 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q8R6M1 1.1e-20 83 38 1 93 3 rpsF Small ribosomal subunit protein bS6 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B3PUT7 1.2e-20 84 37 2 119 3 rpsF Small ribosomal subunit protein bS6 Rhizobium etli (strain CIAT 652)
A1US56 1.24e-20 84 39 2 121 3 rpsF Small ribosomal subunit protein bS6 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
B0UL29 1.8e-20 83 39 1 108 3 rpsF Small ribosomal subunit protein bS6 Methylobacterium sp. (strain 4-46)
Q2KA93 2.32e-20 84 37 2 119 3 rpsF Small ribosomal subunit protein bS6 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q0SPR6 5.5e-20 81 38 1 92 3 rpsF Small ribosomal subunit protein bS6 Clostridium perfringens (strain SM101 / Type A)
Q8XH43 5.5e-20 81 38 1 92 3 rpsF Small ribosomal subunit protein bS6 Clostridium perfringens (strain 13 / Type A)
Q0TM08 5.5e-20 81 38 1 92 3 rpsF Small ribosomal subunit protein bS6 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q2W5G8 5.99e-20 82 37 2 114 3 rpsF Small ribosomal subunit protein bS6 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
B9JUU2 9.98e-20 82 40 1 105 3 rpsF Small ribosomal subunit protein bS6 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q948R9 1e-19 85 35 0 101 1 RFC3 Protein REGULATOR OF FATTY ACID COMPOSITION 3, chloroplastic Arabidopsis thaliana
Q984T8 1.13e-19 82 32 1 125 3 rpsF Small ribosomal subunit protein bS6 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
C3KWI0 1.22e-19 80 39 1 91 3 rpsF Small ribosomal subunit protein bS6 Clostridium botulinum (strain 657 / Type Ba4)
Q2RM72 1.32e-19 80 35 1 93 3 rpsF Small ribosomal subunit protein bS6 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
B0K5L9 1.37e-19 80 37 1 93 3 rpsF Small ribosomal subunit protein bS6 Thermoanaerobacter sp. (strain X514)
B0K8G4 1.37e-19 80 37 1 93 3 rpsF Small ribosomal subunit protein bS6 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
A9W8G4 1.37e-19 81 40 1 105 3 rpsF Small ribosomal subunit protein bS6 Methylorubrum extorquens (strain PA1)
B7L2P2 1.37e-19 81 40 1 105 3 rpsF Small ribosomal subunit protein bS6 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
Q3AG27 1.41e-19 80 35 1 92 3 rpsF Small ribosomal subunit protein bS6 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
B1ZFQ8 1.72e-19 81 40 1 105 3 rpsF Small ribosomal subunit protein bS6 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A5I801 1.87e-19 79 39 1 91 3 rpsF Small ribosomal subunit protein bS6 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FZH1 1.87e-19 79 39 1 91 3 rpsF Small ribosomal subunit protein bS6 Clostridium botulinum (strain ATCC 19397 / Type A)
Q0C085 2.51e-19 80 40 1 111 3 rpsF Small ribosomal subunit protein bS6 Hyphomonas neptunium (strain ATCC 15444)
Q11H16 2.69e-19 80 37 1 105 3 rpsF Small ribosomal subunit protein bS6 Chelativorans sp. (strain BNC1)
B2IHD1 2.71e-19 81 38 1 109 3 rpsF Small ribosomal subunit protein bS6 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
A7GJM4 2.79e-19 79 39 1 91 3 rpsF Small ribosomal subunit protein bS6 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IHQ4 2.79e-19 79 39 1 91 3 rpsF Small ribosomal subunit protein bS6 Clostridium botulinum (strain Okra / Type B1)
C1FP16 2.79e-19 79 39 1 91 3 rpsF Small ribosomal subunit protein bS6 Clostridium botulinum (strain Kyoto / Type A2)
A6U7G7 4.01e-19 80 37 2 114 3 rpsF Small ribosomal subunit protein bS6 Sinorhizobium medicae (strain WSM419)
Q8EKV4 4.02e-19 79 36 1 92 3 rpsF Small ribosomal subunit protein bS6 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B5ZWC9 4.03e-19 80 37 1 108 3 rpsF Small ribosomal subunit protein bS6 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q1MJ10 4.03e-19 80 37 1 108 3 rpsF Small ribosomal subunit protein bS6 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q9K5N8 4.43e-19 79 39 1 92 3 rpsF Small ribosomal subunit protein bS6 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A6M3L2 5.39e-19 78 40 1 91 3 rpsF Small ribosomal subunit protein bS6 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q97CX2 5.45e-19 78 33 1 93 3 rpsF Small ribosomal subunit protein bS6 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B1KU97 7.27e-19 78 38 1 91 3 rpsF Small ribosomal subunit protein bS6 Clostridium botulinum (strain Loch Maree / Type A3)
B1I6T1 1.44e-18 77 35 1 92 3 rpsF Small ribosomal subunit protein bS6 Desulforudis audaxviator (strain MP104C)
B6JGN7 1.51e-18 79 36 1 114 3 rpsF Small ribosomal subunit protein bS6 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
B9M5U8 1.53e-18 78 41 1 87 3 rpsF Small ribosomal subunit protein bS6 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
A4WS85 2.26e-18 78 33 1 123 3 rpsF Small ribosomal subunit protein bS6 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
A4J9Q5 2.63e-18 77 33 1 92 3 rpsF Small ribosomal subunit protein bS6 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q8UGE7 3.23e-18 78 37 1 105 3 rpsF Small ribosomal subunit protein bS6 Agrobacterium fabrum (strain C58 / ATCC 33970)
C4L008 3.53e-18 76 38 1 92 3 rpsF Small ribosomal subunit protein bS6 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
B1LYI4 5.14e-18 77 40 1 105 3 rpsF Small ribosomal subunit protein bS6 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
B9JCB9 5.39e-18 77 37 1 105 3 rpsF Small ribosomal subunit protein bS6 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
A1AM18 5.49e-18 77 36 1 100 3 rpsF Small ribosomal subunit protein bS6 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q92QZ7 6.67e-18 77 39 1 105 3 rpsF Small ribosomal subunit protein bS6 Rhizobium meliloti (strain 1021)
A9IRU5 7.99e-18 77 36 2 122 3 rpsF Small ribosomal subunit protein bS6 Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q6HAG2 9.31e-18 75 35 1 92 3 rpsF Small ribosomal subunit protein bS6 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q630C8 9.31e-18 75 35 1 92 3 rpsF Small ribosomal subunit protein bS6 Bacillus cereus (strain ZK / E33L)
B9IT32 9.31e-18 75 35 1 92 3 rpsF Small ribosomal subunit protein bS6 Bacillus cereus (strain Q1)
B7HZG1 9.31e-18 75 35 1 92 3 rpsF Small ribosomal subunit protein bS6 Bacillus cereus (strain AH187)
C1ER67 9.31e-18 75 35 1 92 3 rpsF Small ribosomal subunit protein bS6 Bacillus cereus (strain 03BB102)
B7JIK1 9.31e-18 75 35 1 92 3 rpsF Small ribosomal subunit protein bS6 Bacillus cereus (strain AH820)
Q81JI2 9.31e-18 75 35 1 92 1 rpsF Small ribosomal subunit protein bS6 Bacillus anthracis
C3LGT1 9.31e-18 75 35 1 92 3 rpsF Small ribosomal subunit protein bS6 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P3E5 9.31e-18 75 35 1 92 3 rpsF Small ribosomal subunit protein bS6 Bacillus anthracis (strain A0248)
A5G7R3 1.33e-17 76 38 1 97 3 rpsF Small ribosomal subunit protein bS6 Geotalea uraniireducens (strain Rf4)
Q6G446 1.43e-17 76 37 2 124 3 rpsF Small ribosomal subunit protein bS6 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A7HYI2 1.68e-17 76 35 1 106 3 rpsF Small ribosomal subunit protein bS6 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A9VTL0 1.82e-17 74 34 1 92 3 rpsF Small ribosomal subunit protein bS6 Bacillus mycoides (strain KBAB4)
Q814G5 1.84e-17 74 34 1 92 3 rpsF Small ribosomal subunit protein bS6 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HGD4 1.84e-17 74 34 1 92 3 rpsF Small ribosomal subunit protein bS6 Bacillus cereus (strain B4264)
Q72WV3 1.84e-17 74 34 1 92 3 rpsF Small ribosomal subunit protein bS6 Bacillus cereus (strain ATCC 10987 / NRS 248)
C3M9B1 2.02e-17 76 37 1 105 3 rpsF Small ribosomal subunit protein bS6 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B3CRZ7 2.02e-17 75 34 1 105 3 rpsF Small ribosomal subunit protein bS6 Orientia tsutsugamushi (strain Ikeda)
Q1GRW0 2.12e-17 75 40 1 105 3 rpsF Small ribosomal subunit protein bS6 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
A5CCY7 2.15e-17 75 34 1 105 3 rpsF Small ribosomal subunit protein bS6 Orientia tsutsugamushi (strain Boryong)
Q65CP3 2.38e-17 74 35 1 92 3 rpsF Small ribosomal subunit protein bS6 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B7IS18 2.66e-17 74 34 1 92 3 rpsF Small ribosomal subunit protein bS6 Bacillus cereus (strain G9842)
C6E503 4.15e-17 75 36 1 100 3 rpsF Small ribosomal subunit protein bS6 Geobacter sp. (strain M21)
Q6MRP3 6.07e-17 75 43 1 90 3 rpsF Small ribosomal subunit protein bS6 Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q2G8G3 6.53e-17 73 41 1 105 3 rpsF Small ribosomal subunit protein bS6 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
B3Q9T5 6.58e-17 75 38 1 102 3 rpsF Small ribosomal subunit protein bS6 Rhodopseudomonas palustris (strain TIE-1)
Q6N5A4 6.58e-17 75 38 1 102 1 rpsF Small ribosomal subunit protein bS6 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A5CY52 6.81e-17 73 33 1 92 3 rpsF Small ribosomal subunit protein bS6 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q3J1M1 7.07e-17 74 34 1 110 3 rpsF Small ribosomal subunit protein bS6 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A5N440 7.51e-17 73 34 1 92 3 rpsF Small ribosomal subunit protein bS6 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DXR0 7.51e-17 73 34 1 92 3 rpsF Small ribosomal subunit protein bS6 Clostridium kluyveri (strain NBRC 12016)
B9KJP0 7.6e-17 74 34 1 110 3 rpsF Small ribosomal subunit protein bS6 Cereibacter sphaeroides (strain KD131 / KCTC 12085)
A3PKL5 7.6e-17 74 34 1 110 3 rpsF Small ribosomal subunit protein bS6 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
B5EHW9 7.92e-17 74 36 1 100 3 rpsF Small ribosomal subunit protein bS6 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
A7GVN7 1.13e-16 72 33 1 92 3 rpsF Small ribosomal subunit protein bS6 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A6Q464 1.15e-16 73 35 4 129 3 rpsF Small ribosomal subunit protein bS6 Nitratiruptor sp. (strain SB155-2)
Q6G060 1.21e-16 73 37 1 108 3 rpsF Small ribosomal subunit protein bS6 Bartonella quintana (strain Toulouse)
Q5WAH3 1.38e-16 72 36 1 92 3 rpsF Small ribosomal subunit protein bS6 Shouchella clausii (strain KSM-K16)
A8HVF1 1.81e-16 73 34 1 108 3 rpsF Small ribosomal subunit protein bS6 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A7IK05 3.27e-16 73 38 1 102 3 rpsF Small ribosomal subunit protein bS6 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q68XR5 3.27e-16 72 32 1 105 3 rpsF Small ribosomal subunit protein bS6 Rickettsia typhi (strain ATCC VR-144 / Wilmington)
C3PKD0 3.55e-16 71 33 1 92 3 rpsF Small ribosomal subunit protein bS6 Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q2IX91 3.65e-16 73 36 1 102 3 rpsF Small ribosomal subunit protein bS6 Rhodopseudomonas palustris (strain HaA2)
Q89MW3 4.16e-16 73 37 1 105 3 rpsF Small ribosomal subunit protein bS6 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q3A317 4.16e-16 72 37 1 87 3 rpsF Small ribosomal subunit protein bS6 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q215T6 4.24e-16 73 37 1 102 3 rpsF Small ribosomal subunit protein bS6 Rhodopseudomonas palustris (strain BisB18)
Q07LE2 4.98e-16 72 38 1 102 3 rpsF Small ribosomal subunit protein bS6 Rhodopseudomonas palustris (strain BisA53)
Q1QKV0 4.99e-16 72 37 1 102 3 rpsF Small ribosomal subunit protein bS6 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q3SRY9 5.73e-16 72 36 1 102 3 rpsF Small ribosomal subunit protein bS6 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A4YT77 7.15e-16 72 37 1 102 3 rpsF Small ribosomal subunit protein bS6 Bradyrhizobium sp. (strain ORS 278)
A6WWE6 7.62e-16 72 38 1 93 3 rpsF Small ribosomal subunit protein bS6 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q135M8 8.42e-16 72 36 1 102 3 rpsF Small ribosomal subunit protein bS6 Rhodopseudomonas palustris (strain BisB5)
B3E6H3 1.05e-15 71 30 2 108 3 rpsF Small ribosomal subunit protein bS6 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
A5EI98 1.12e-15 71 37 1 102 3 rpsF Small ribosomal subunit protein bS6 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
B8ESH8 1.71e-15 71 35 1 105 3 rpsF Small ribosomal subunit protein bS6 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
B1YG99 1.81e-15 69 31 1 92 3 rpsF Small ribosomal subunit protein bS6 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
C4LGG1 1.87e-15 69 32 1 92 3 rpsF Small ribosomal subunit protein bS6 Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
B1VPC4 1.97e-15 69 33 1 92 3 rpsF Small ribosomal subunit protein bS6 Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
B0CKD9 2.44e-15 70 35 1 104 3 rpsF Small ribosomal subunit protein bS6 Brucella suis (strain ATCC 23445 / NCTC 10510)
Q8FLP8 2.86e-15 69 30 1 93 3 rpsF Small ribosomal subunit protein bS6 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q6NEI3 3.05e-15 68 31 1 92 3 rpsF Small ribosomal subunit protein bS6 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
C0RHG2 3.59e-15 70 35 1 104 3 rpsF Small ribosomal subunit protein bS6 Brucella melitensis biotype 2 (strain ATCC 23457)
Q57ER2 3.59e-15 70 35 1 104 3 rpsF Small ribosomal subunit protein bS6 Brucella abortus biovar 1 (strain 9-941)
Q2YMG9 3.59e-15 70 35 1 104 3 rpsF Small ribosomal subunit protein bS6 Brucella abortus (strain 2308)
B2S9V4 3.59e-15 70 35 1 104 3 rpsF Small ribosomal subunit protein bS6 Brucella abortus (strain S19)
Q8G274 3.83e-15 70 35 1 104 3 rpsF Small ribosomal subunit protein bS6 Brucella suis biovar 1 (strain 1330)
A9M8X8 3.83e-15 70 35 1 104 3 rpsF Small ribosomal subunit protein bS6 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q39RR2 4.81e-15 69 35 1 93 3 rpsF Small ribosomal subunit protein bS6 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q9X8U2 5.09e-15 68 32 1 92 3 rpsF Small ribosomal subunit protein bS6 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9ZEA6 5.4e-15 69 32 1 105 3 rpsF Small ribosomal subunit protein bS6 Rickettsia prowazekii (strain Madrid E)
B1VIZ8 5.9e-15 68 30 1 92 3 rpsF Small ribosomal subunit protein bS6 Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
C1F904 5.91e-15 69 36 1 92 3 rpsF Small ribosomal subunit protein bS6 Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
Q5FU57 6.34e-15 70 35 1 108 3 rpsF Small ribosomal subunit protein bS6 Gluconobacter oxydans (strain 621H)
P21468 6.79e-15 68 31 1 92 1 rpsF Small ribosomal subunit protein bS6 Bacillus subtilis (strain 168)
B0SWL1 7.54e-15 68 37 3 120 3 rpsF Small ribosomal subunit protein bS6 Caulobacter sp. (strain K31)
Q181R5 7.65e-15 68 34 0 90 3 rpsF Small ribosomal subunit protein bS6 Clostridioides difficile (strain 630)
Q82FG4 8.19e-15 68 32 1 92 3 rpsF Small ribosomal subunit protein bS6 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
B0JSQ9 9.11e-15 68 31 3 124 3 rpsF Small ribosomal subunit protein bS6 Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
A7ZAU9 9.19e-15 67 31 1 92 3 rpsF Small ribosomal subunit protein bS6 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q4JSF9 9.6e-15 67 30 1 92 3 rpsF Small ribosomal subunit protein bS6 Corynebacterium jeikeium (strain K411)
B7KD42 1.12e-14 69 38 1 92 3 rpsF Small ribosomal subunit protein bS6 Gloeothece citriformis (strain PCC 7424)
Q1RKB1 1.16e-14 68 35 1 105 3 rpsF Small ribosomal subunit protein bS6 Rickettsia bellii (strain RML369-C)
A8GY12 1.34e-14 68 35 1 105 3 rpsF Small ribosomal subunit protein bS6 Rickettsia bellii (strain OSU 85-389)
Q8NLF9 1.78e-14 67 29 1 93 3 rpsF Small ribosomal subunit protein bS6 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A8FJE7 1.8e-14 67 31 1 92 3 rpsF Small ribosomal subunit protein bS6 Bacillus pumilus (strain SAFR-032)
Q5NN61 1.93e-14 67 37 1 102 3 rpsF Small ribosomal subunit protein bS6 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
B8GVN6 1.96e-14 67 36 2 118 3 rpsF Small ribosomal subunit protein bS6 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A7Q1 1.96e-14 67 36 2 118 3 rpsF Small ribosomal subunit protein bS6 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
C5D9X6 2.02e-14 67 31 1 92 3 rpsF Small ribosomal subunit protein bS6 Geobacillus sp. (strain WCH70)
Q6A5M9 2.03e-14 67 33 1 92 1 rpsF Small ribosomal subunit protein bS6 Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q24MB7 2.05e-14 67 30 1 92 3 rpsF Small ribosomal subunit protein bS6 Desulfitobacterium hafniense (strain Y51)
B8G0J4 2.05e-14 67 30 1 92 3 rpsF Small ribosomal subunit protein bS6 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q2RXC6 2.25e-14 68 35 1 105 3 rpsF Small ribosomal subunit protein bS6 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
C0QBV4 2.46e-14 68 29 1 97 3 rpsF Small ribosomal subunit protein bS6 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
Q92JK3 2.77e-14 67 32 1 105 3 rpsF Small ribosomal subunit protein bS6 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
A8GQJ4 2.8e-14 67 32 1 105 3 rpsF Small ribosomal subunit protein bS6 Rickettsia rickettsii (strain Sheila Smith)
C4K159 2.8e-14 67 32 1 105 3 rpsF Small ribosomal subunit protein bS6 Rickettsia peacockii (strain Rustic)
B9DIB8 2.83e-14 66 34 2 93 3 rpsF Small ribosomal subunit protein bS6 Staphylococcus carnosus (strain TM300)
B0TE72 2.9e-14 66 32 1 92 3 rpsF Small ribosomal subunit protein bS6 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q8YFP0 3.05e-14 67 34 1 104 3 rpsF Small ribosomal subunit protein bS6 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9H1N0 3.17e-14 68 34 1 112 3 rpsF Small ribosomal subunit protein bS6 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
A8EXA7 3.87e-14 67 32 1 105 3 rpsF Small ribosomal subunit protein bS6 Rickettsia canadensis (strain McKiel)
A8MED4 4.03e-14 66 33 2 93 3 rpsF Small ribosomal subunit protein bS6 Alkaliphilus oremlandii (strain OhILAs)
A1B0F8 6.45e-14 66 37 1 98 3 rpsF Small ribosomal subunit protein bS6 Paracoccus denitrificans (strain Pd 1222)
Q01QR4 6.72e-14 67 34 1 92 3 rpsF Small ribosomal subunit protein bS6 Solibacter usitatus (strain Ellin6076)
C5C7V1 8.59e-14 65 31 1 92 3 rpsF Small ribosomal subunit protein bS6 Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
B8E0J2 9.55e-14 65 32 1 90 3 rpsF Small ribosomal subunit protein bS6 Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
Q7MQZ8 1.01e-13 66 35 1 92 3 rpsF Small ribosomal subunit protein bS6 Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
B9KCI6 1.34e-13 65 34 1 92 3 rpsF Small ribosomal subunit protein bS6 Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
A8LXG3 1.47e-13 64 34 1 92 3 rpsF Small ribosomal subunit protein bS6 Salinispora arenicola (strain CNS-205)
A8LQQ5 1.77e-13 65 33 1 98 3 rpsF Small ribosomal subunit protein bS6 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q5KU69 2.59e-13 64 29 1 92 3 rpsF Small ribosomal subunit protein bS6 Geobacillus kaustophilus (strain HTA426)
O68126 2.67e-13 65 34 1 98 3 rpsF Small ribosomal subunit protein bS6 Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q4UN64 3.04e-13 64 31 1 105 3 rpsF Small ribosomal subunit protein bS6 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A4FR32 4.05e-13 64 33 1 92 3 rpsF Small ribosomal subunit protein bS6 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
A4XDG8 4.17e-13 63 33 1 92 3 rpsF Small ribosomal subunit protein bS6 Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
B2GJD8 4.93e-13 63 31 1 92 3 rpsF Small ribosomal subunit protein bS6 Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
Q1GHT8 5.23e-13 63 32 1 98 3 rpsF Small ribosomal subunit protein bS6 Ruegeria sp. (strain TM1040)
Q49UQ0 6.11e-13 63 31 2 93 3 rpsF Small ribosomal subunit protein bS6 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
O66474 6.32e-13 63 38 3 98 1 rpsF Small ribosomal subunit protein bS6 Aquifex aeolicus (strain VF5)
Q64PH7 6.58e-13 63 39 3 100 3 rpsF Small ribosomal subunit protein bS6 Bacteroides fragilis (strain YCH46)
Q5L9B5 6.58e-13 63 39 3 100 3 rpsF Small ribosomal subunit protein bS6 Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q5HU34 7.86e-13 63 33 1 92 3 rpsF Small ribosomal subunit protein bS6 Campylobacter jejuni (strain RM1221)
A6KWD7 8.43e-13 63 35 1 93 3 rpsF Small ribosomal subunit protein bS6 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q17Z31 9.2e-13 63 38 1 92 3 rpsF Small ribosomal subunit protein bS6 Helicobacter acinonychis (strain Sheeba)
B6IN79 9.56e-13 64 30 1 113 3 rpsF Small ribosomal subunit protein bS6 Rhodospirillum centenum (strain ATCC 51521 / SW)
Q0BPZ0 1.01e-12 64 34 1 112 3 rpsF Small ribosomal subunit protein bS6 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
P66596 1.32e-12 62 31 2 93 3 rpsF Small ribosomal subunit protein bS6 Staphylococcus aureus (strain MW2)
A8YZJ1 1.32e-12 62 31 2 93 3 rpsF Small ribosomal subunit protein bS6 Staphylococcus aureus (strain USA300 / TCH1516)
Q6GCA7 1.32e-12 62 31 2 93 3 rpsF Small ribosomal subunit protein bS6 Staphylococcus aureus (strain MSSA476)
Q6GJV3 1.32e-12 62 31 2 93 3 rpsF Small ribosomal subunit protein bS6 Staphylococcus aureus (strain MRSA252)
P99142 1.32e-12 62 31 2 93 1 rpsF Small ribosomal subunit protein bS6 Staphylococcus aureus (strain N315)
P66595 1.32e-12 62 31 2 93 3 rpsF Small ribosomal subunit protein bS6 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QE47 1.32e-12 62 31 2 93 3 rpsF Small ribosomal subunit protein bS6 Staphylococcus aureus (strain Newman)
Q5HIS9 1.32e-12 62 31 2 93 3 rpsF Small ribosomal subunit protein bS6 Staphylococcus aureus (strain COL)
Q2YVJ2 1.32e-12 62 31 2 93 1 rpsF Small ribosomal subunit protein bS6 Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IPU6 1.32e-12 62 31 2 93 3 rpsF Small ribosomal subunit protein bS6 Staphylococcus aureus (strain JH9)
Q2G113 1.32e-12 62 31 2 93 1 rpsF Small ribosomal subunit protein bS6 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJP8 1.32e-12 62 31 2 93 3 rpsF Small ribosomal subunit protein bS6 Staphylococcus aureus (strain USA300)
A6TYL8 1.32e-12 62 31 2 93 3 rpsF Small ribosomal subunit protein bS6 Staphylococcus aureus (strain JH1)
A7WY58 1.32e-12 62 31 2 93 3 rpsF Small ribosomal subunit protein bS6 Staphylococcus aureus (strain Mu3 / ATCC 700698)
A1W057 1.37e-12 63 33 1 92 3 rpsF Small ribosomal subunit protein bS6 Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A7H2T4 1.37e-12 63 33 1 92 3 rpsF Small ribosomal subunit protein bS6 Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A8FMC3 1.37e-12 63 33 1 92 3 rpsF Small ribosomal subunit protein bS6 Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q5LR50 1.53e-12 62 32 1 98 3 rpsF Small ribosomal subunit protein bS6 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
B8FI57 1.57e-12 64 31 1 97 3 rpsF Small ribosomal subunit protein bS6 Desulfatibacillum aliphaticivorans
C5C661 1.68e-12 62 30 1 92 3 rpsF Small ribosomal subunit protein bS6 Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
Q164N7 2.11e-12 62 33 1 98 3 rpsF Small ribosomal subunit protein bS6 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
B8H841 2.22e-12 62 32 1 92 3 rpsF Small ribosomal subunit protein bS6 Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
Q8A5S5 2.47e-12 62 38 3 100 3 rpsF Small ribosomal subunit protein bS6 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
B0S2G9 2.57e-12 61 31 0 92 3 rpsF Small ribosomal subunit protein bS6 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
B5YEW9 2.94e-12 61 31 1 90 3 rpsF Small ribosomal subunit protein bS6 Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
Q8CQP4 2.98e-12 61 31 2 93 3 rpsF Small ribosomal subunit protein bS6 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRZ5 2.98e-12 61 31 2 93 3 rpsF Small ribosomal subunit protein bS6 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q9ZAH3 3.23e-12 62 32 1 92 3 rpsF Small ribosomal subunit protein bS6 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q1XDC8 3.26e-12 61 30 1 101 3 rps6 Small ribosomal subunit protein bS6c Neopyropia yezoensis
P56013 3.27e-12 62 38 1 92 1 rpsF Small ribosomal subunit protein bS6 Helicobacter pylori (strain ATCC 700392 / 26695)
Q74FE4 3.34e-12 62 33 1 87 3 rpsF Small ribosomal subunit protein bS6 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q1CS16 3.56e-12 62 38 1 92 3 rpsF Small ribosomal subunit protein bS6 Helicobacter pylori (strain HPAG1)
B5Z8P2 3.64e-12 62 38 1 92 3 rpsF Small ribosomal subunit protein bS6 Helicobacter pylori (strain G27)
Q8DJE6 3.87e-12 61 31 1 90 3 rpsF Small ribosomal subunit protein bS6 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
B2UV11 4.09e-12 62 38 1 92 3 rpsF Small ribosomal subunit protein bS6 Helicobacter pylori (strain Shi470)
A7I006 6.31e-12 62 33 1 92 3 rpsF Small ribosomal subunit protein bS6 Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
A0K2H5 7.03e-12 60 31 1 92 3 rpsF Small ribosomal subunit protein bS6 Arthrobacter sp. (strain FB24)
Q6ABW7 7.14e-12 61 28 1 105 3 rpsF Small ribosomal subunit protein bS6 Leifsonia xyli subsp. xyli (strain CTCB07)
Q5YN17 7.55e-12 60 31 1 92 3 rpsF Small ribosomal subunit protein bS6 Nocardia farcinica (strain IFM 10152)
B1WU11 7.65e-12 60 32 1 94 3 rpsF Small ribosomal subunit protein bS6 Crocosphaera subtropica (strain ATCC 51142 / BH68)
A6H0P3 7.67e-12 60 33 2 99 3 rpsF Small ribosomal subunit protein bS6 Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
A8ZRQ3 8.15e-12 62 34 1 91 3 rpsF Small ribosomal subunit protein bS6 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q839Z0 9.27e-12 60 30 2 92 1 rpsF Small ribosomal subunit protein bS6 Enterococcus faecalis (strain ATCC 700802 / V583)
P46389 9.69e-12 60 34 2 96 3 rpsF Small ribosomal subunit protein bS6 Mycobacterium leprae (strain TN)
A0LN59 9.84e-12 61 29 1 93 3 rpsF Small ribosomal subunit protein bS6 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q7MWL3 1.12e-11 60 38 3 93 3 rpsF Small ribosomal subunit protein bS6 Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RIG3 1.12e-11 60 38 3 93 3 rpsF Small ribosomal subunit protein bS6 Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q9ZJY1 1.16e-11 61 36 1 92 3 rpsF Small ribosomal subunit protein bS6 Helicobacter pylori (strain J99 / ATCC 700824)
B6JN86 1.16e-11 61 36 1 92 3 rpsF Small ribosomal subunit protein bS6 Helicobacter pylori (strain P12)
P9WH31 1.19e-11 60 32 1 92 1 rpsF Small ribosomal subunit protein bS6 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WH30 1.19e-11 60 32 1 92 3 rpsF Small ribosomal subunit protein bS6 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5TYC4 1.19e-11 60 32 1 92 3 rpsF Small ribosomal subunit protein bS6 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AJ76 1.19e-11 60 32 1 92 3 rpsF Small ribosomal subunit protein bS6 Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KEM1 1.19e-11 60 32 1 92 3 rpsF Small ribosomal subunit protein bS6 Mycobacterium bovis (strain BCG / Pasteur 1173P2)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_11845
Feature type CDS
Gene rpsF
Product 30S ribosomal protein S6
Location 82198 - 82587 (strand: -1)
Length 390 (nucleotides) / 129 (amino acids)

Contig

Accession ZDB_689
Length 162442 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1373
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01250 Ribosomal protein S6

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0360 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein S6

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02990 small subunit ribosomal protein S6 Ribosome -

Protein Sequence

MRHYEIVFMVHPDQSEQVPAMIERYKTAITNAEGQIHRLEDWGRRQLAYPINKLHKAHYVLLNVEAPQEVIDELETIFRFNDAVIRSMVMRVKHAVTEPSPMVKAKDERRPRDMSDDIEENDEAEETEE

Flanking regions ( +/- flanking 50bp)

GGTTGCGGTTGCCCGGACAGGAGGCTAATAATCCGTAAGGAGCACTACTAATGCGTCATTACGAAATCGTCTTCATGGTTCATCCGGACCAGAGCGAACAAGTACCGGCAATGATCGAGCGTTATAAAACTGCTATTACTAACGCAGAAGGTCAGATCCACCGTCTCGAAGACTGGGGTCGTCGCCAACTGGCTTACCCAATCAACAAACTGCACAAAGCGCACTACGTTCTGCTGAACGTTGAAGCTCCGCAGGAAGTGATTGACGAGCTGGAAACTATTTTCCGCTTCAATGATGCCGTTATCCGCAGCATGGTTATGCGCGTTAAGCACGCGGTGACTGAACCTTCTCCAATGGTTAAAGCGAAAGACGAACGTCGCCCGCGCGACATGTCTGACGACATTGAAGAAAATGATGAAGCTGAGGAAACTGAAGAGTAATAACGGTGTCCGCTAACCGTCTGGTGTTATCCGGCACAGTGTGCAGGGAA