Homologs in group_1447

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08595 FBDBKF_08595 100.0 Morganella morganii S1 rplU 50S ribosomal protein L21
EHELCC_12930 EHELCC_12930 100.0 Morganella morganii S2 rplU 50S ribosomal protein L21
NLDBIP_13270 NLDBIP_13270 100.0 Morganella morganii S4 rplU 50S ribosomal protein L21
LHKJJB_13285 LHKJJB_13285 100.0 Morganella morganii S3 rplU 50S ribosomal protein L21
F4V73_RS09820 F4V73_RS09820 98.0 Morganella psychrotolerans rplU 50S ribosomal protein L21
PMI_RS16950 PMI_RS16950 83.3 Proteus mirabilis HI4320 rplU 50S ribosomal protein L21

Distribution of the homologs in the orthogroup group_1447

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1447

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7MYX4 6.82e-66 196 95 0 102 3 rplU Large ribosomal subunit protein bL21 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B2VGS9 5.4e-62 186 88 0 102 3 rplU Large ribosomal subunit protein bL21 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B1JMJ7 3.77e-61 184 85 0 102 3 rplU Large ribosomal subunit protein bL21 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66F76 3.77e-61 184 85 0 102 3 rplU Large ribosomal subunit protein bL21 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TRJ9 3.77e-61 184 85 0 102 3 rplU Large ribosomal subunit protein bL21 Yersinia pestis (strain Pestoides F)
Q1CEJ7 3.77e-61 184 85 0 102 3 rplU Large ribosomal subunit protein bL21 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R587 3.77e-61 184 85 0 102 3 rplU Large ribosomal subunit protein bL21 Yersinia pestis bv. Antiqua (strain Angola)
Q0WBD7 3.77e-61 184 85 0 102 3 rplU Large ribosomal subunit protein bL21 Yersinia pestis
B2K2N9 3.77e-61 184 85 0 102 3 rplU Large ribosomal subunit protein bL21 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CBZ1 3.77e-61 184 85 0 102 3 rplU Large ribosomal subunit protein bL21 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FMT8 3.77e-61 184 85 0 102 3 rplU Large ribosomal subunit protein bL21 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8G8Z1 7.53e-61 183 87 0 102 3 rplU Large ribosomal subunit protein bL21 Serratia proteamaculans (strain 568)
B4F2A6 1.01e-60 183 83 0 102 3 rplU Large ribosomal subunit protein bL21 Proteus mirabilis (strain HI4320)
A6VMT8 3.78e-60 182 86 0 101 3 rplU Large ribosomal subunit protein bL21 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q9CNS8 4.36e-60 181 86 0 101 3 rplU Large ribosomal subunit protein bL21 Pasteurella multocida (strain Pm70)
C6DKH6 9.93e-60 181 87 0 102 3 rplU Large ribosomal subunit protein bL21 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q7VP92 1.41e-59 180 86 0 101 3 rplU Large ribosomal subunit protein bL21 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q65S54 2.5e-59 179 87 0 101 3 rplU Large ribosomal subunit protein bL21 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A3N3T7 2.64e-59 179 86 0 101 3 rplU Large ribosomal subunit protein bL21 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q87SU4 2.94e-59 179 86 0 101 3 rplU Large ribosomal subunit protein bL21 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A1JIV3 4.32e-59 179 85 0 102 3 rplU Large ribosomal subunit protein bL21 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q7MP94 4.88e-59 179 85 0 101 3 rplU Large ribosomal subunit protein bL21 Vibrio vulnificus (strain YJ016)
Q8DEC4 4.88e-59 179 85 0 101 3 rplU Large ribosomal subunit protein bL21 Vibrio vulnificus (strain CMCP6)
Q3LT96 4.88e-59 179 85 0 101 3 rplU Large ribosomal subunit protein bL21 Vibrio harveyi
C3LRG6 4.88e-59 179 85 0 101 3 rplU Large ribosomal subunit protein bL21 Vibrio cholerae serotype O1 (strain M66-2)
Q9KUT0 4.88e-59 179 85 0 101 3 rplU Large ribosomal subunit protein bL21 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F8P0 4.88e-59 179 85 0 101 3 rplU Large ribosomal subunit protein bL21 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A7MWE0 4.88e-59 179 85 0 101 3 rplU Large ribosomal subunit protein bL21 Vibrio campbellii (strain ATCC BAA-1116)
Q6D9C6 9.95e-59 178 86 0 102 3 rplU Large ribosomal subunit protein bL21 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A5UI25 1.17e-58 178 84 0 101 3 rplU Large ribosomal subunit protein bL21 Haemophilus influenzae (strain PittGG)
A5UDJ4 1.17e-58 178 84 0 101 3 rplU Large ribosomal subunit protein bL21 Haemophilus influenzae (strain PittEE)
B3GZE5 1.43e-58 177 85 0 101 3 rplU Large ribosomal subunit protein bL21 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q4QM28 1.92e-58 177 83 0 101 3 rplU Large ribosomal subunit protein bL21 Haemophilus influenzae (strain 86-028NP)
A6TEK5 2.76e-58 177 85 0 102 3 rplU Large ribosomal subunit protein bL21 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XSV5 2.76e-58 177 85 0 102 3 rplU Large ribosomal subunit protein bL21 Klebsiella pneumoniae (strain 342)
P0AG50 3.84e-58 177 84 0 102 3 rplU Large ribosomal subunit protein bL21 Shigella flexneri
Q0T098 3.84e-58 177 84 0 102 3 rplU Large ribosomal subunit protein bL21 Shigella flexneri serotype 5b (strain 8401)
Q32BE7 3.84e-58 177 84 0 102 3 rplU Large ribosomal subunit protein bL21 Shigella dysenteriae serotype 1 (strain Sd197)
Q31W63 3.84e-58 177 84 0 102 3 rplU Large ribosomal subunit protein bL21 Shigella boydii serotype 4 (strain Sb227)
B2U1Z1 3.84e-58 177 84 0 102 3 rplU Large ribosomal subunit protein bL21 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B4TWF6 3.84e-58 177 84 0 102 3 rplU Large ribosomal subunit protein bL21 Salmonella schwarzengrund (strain CVM19633)
B7LR53 3.84e-58 177 84 0 102 3 rplU Large ribosomal subunit protein bL21 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R6F0 3.84e-58 177 84 0 102 3 rplU Large ribosomal subunit protein bL21 Escherichia coli (strain UTI89 / UPEC)
B1LGF2 3.84e-58 177 84 0 102 3 rplU Large ribosomal subunit protein bL21 Escherichia coli (strain SMS-3-5 / SECEC)
B6I1Q9 3.84e-58 177 84 0 102 3 rplU Large ribosomal subunit protein bL21 Escherichia coli (strain SE11)
B7NDH0 3.84e-58 177 84 0 102 3 rplU Large ribosomal subunit protein bL21 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0AG48 3.84e-58 177 84 0 102 1 rplU Large ribosomal subunit protein bL21 Escherichia coli (strain K12)
B1IQT7 3.84e-58 177 84 0 102 3 rplU Large ribosomal subunit protein bL21 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0TCS4 3.84e-58 177 84 0 102 3 rplU Large ribosomal subunit protein bL21 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A501 3.84e-58 177 84 0 102 3 rplU Large ribosomal subunit protein bL21 Escherichia coli O9:H4 (strain HS)
B1XHG2 3.84e-58 177 84 0 102 3 rplU Large ribosomal subunit protein bL21 Escherichia coli (strain K12 / DH10B)
C4ZSS5 3.84e-58 177 84 0 102 3 rplU Large ribosomal subunit protein bL21 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M092 3.84e-58 177 84 0 102 3 rplU Large ribosomal subunit protein bL21 Escherichia coli O8 (strain IAI1)
B7N0W8 3.84e-58 177 84 0 102 3 rplU Large ribosomal subunit protein bL21 Escherichia coli O81 (strain ED1a)
B7NKQ3 3.84e-58 177 84 0 102 3 rplU Large ribosomal subunit protein bL21 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YS75 3.84e-58 177 84 0 102 3 rplU Large ribosomal subunit protein bL21 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0AG49 3.84e-58 177 84 0 102 3 rplU Large ribosomal subunit protein bL21 Escherichia coli O157:H7
B7LHP9 3.84e-58 177 84 0 102 3 rplU Large ribosomal subunit protein bL21 Escherichia coli (strain 55989 / EAEC)
B7MBV5 3.84e-58 177 84 0 102 3 rplU Large ribosomal subunit protein bL21 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UJ79 3.84e-58 177 84 0 102 3 rplU Large ribosomal subunit protein bL21 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZS83 3.84e-58 177 84 0 102 3 rplU Large ribosomal subunit protein bL21 Escherichia coli O139:H28 (strain E24377A / ETEC)
Q7CPP7 5.95e-58 176 83 0 102 3 rplU Large ribosomal subunit protein bL21 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XGA0 5.95e-58 176 83 0 102 3 rplU Large ribosomal subunit protein bL21 Salmonella typhi
A9N753 5.95e-58 176 83 0 102 3 rplU Large ribosomal subunit protein bL21 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T717 5.95e-58 176 83 0 102 3 rplU Large ribosomal subunit protein bL21 Salmonella newport (strain SL254)
B4TJ24 5.95e-58 176 83 0 102 3 rplU Large ribosomal subunit protein bL21 Salmonella heidelberg (strain SL476)
B5REQ2 5.95e-58 176 83 0 102 3 rplU Large ribosomal subunit protein bL21 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R0H7 5.95e-58 176 83 0 102 3 rplU Large ribosomal subunit protein bL21 Salmonella enteritidis PT4 (strain P125109)
B5F6V5 5.95e-58 176 83 0 102 3 rplU Large ribosomal subunit protein bL21 Salmonella agona (strain SL483)
P44359 6.57e-58 176 83 0 101 3 rplU Large ribosomal subunit protein bL21 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B5FGF7 7.18e-58 176 81 0 102 3 rplU Large ribosomal subunit protein bL21 Aliivibrio fischeri (strain MJ11)
Q5E873 7.18e-58 176 81 0 102 3 rplU Large ribosomal subunit protein bL21 Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5BGL0 8.65e-58 176 83 0 102 3 rplU Large ribosomal subunit protein bL21 Salmonella paratyphi A (strain AKU_12601)
Q5PLB4 8.65e-58 176 83 0 102 3 rplU Large ribosomal subunit protein bL21 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B8F875 9.87e-58 176 83 0 101 3 rplU Large ribosomal subunit protein bL21 Glaesserella parasuis serovar 5 (strain SH0165)
Q5R027 1.89e-57 175 83 0 101 3 rplU Large ribosomal subunit protein bL21 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A4WEZ9 2.06e-57 175 83 0 102 3 rplU Large ribosomal subunit protein bL21 Enterobacter sp. (strain 638)
B4RZH5 2.15e-57 175 81 0 101 3 rplU1 Large ribosomal subunit protein bL21 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B0UVH9 2.32e-57 174 82 0 101 3 rplU Large ribosomal subunit protein bL21 Histophilus somni (strain 2336)
Q0I1P8 2.32e-57 174 82 0 101 3 rplU Large ribosomal subunit protein bL21 Histophilus somni (strain 129Pt)
Q3YX55 2.37e-57 174 83 0 102 3 rplU Large ribosomal subunit protein bL21 Shigella sonnei (strain Ss046)
B7VID3 3.19e-57 174 82 0 101 3 rplU Large ribosomal subunit protein bL21 Vibrio atlanticus (strain LGP32)
B6EL41 7.77e-57 173 79 0 102 3 rplU Large ribosomal subunit protein bL21 Aliivibrio salmonicida (strain LFI1238)
Q2NW37 2.18e-56 172 82 0 102 3 rplU Large ribosomal subunit protein bL21 Sodalis glossinidius (strain morsitans)
Q6LV49 5.67e-55 169 78 0 102 3 rplU Large ribosomal subunit protein bL21 Photobacterium profundum (strain SS9)
Q15PE8 2.05e-54 167 76 0 102 3 rplU Large ribosomal subunit protein bL21 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q3IFF4 9e-54 166 77 0 102 3 rplU Large ribosomal subunit protein bL21 Pseudoalteromonas translucida (strain TAC 125)
A0KGS7 4.73e-52 161 74 0 102 3 rplU Large ribosomal subunit protein bL21 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q21M09 7.58e-52 160 70 0 102 3 rplU Large ribosomal subunit protein bL21 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A4SR19 1.1e-51 160 74 0 102 3 rplU Large ribosomal subunit protein bL21 Aeromonas salmonicida (strain A449)
A3QB93 1.93e-51 160 73 0 101 3 rplU Large ribosomal subunit protein bL21 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A9L428 2.65e-51 159 73 0 101 3 rplU Large ribosomal subunit protein bL21 Shewanella baltica (strain OS195)
A6WK49 2.65e-51 159 73 0 101 3 rplU Large ribosomal subunit protein bL21 Shewanella baltica (strain OS185)
A3D178 2.65e-51 159 73 0 101 3 rplU Large ribosomal subunit protein bL21 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EC06 2.65e-51 159 73 0 101 3 rplU Large ribosomal subunit protein bL21 Shewanella baltica (strain OS223)
Q1R0C2 3.19e-51 159 69 0 102 3 rplU Large ribosomal subunit protein bL21 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
C4L9M3 6.03e-51 158 74 0 101 3 rplU Large ribosomal subunit protein bL21 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B1KGG9 8.01e-51 158 74 0 101 3 rplU Large ribosomal subunit protein bL21 Shewanella woodyi (strain ATCC 51908 / MS32)
A1SSB4 8.1e-51 158 73 0 101 3 rplU Large ribosomal subunit protein bL21 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
C4K901 1.11e-50 158 72 0 101 3 rplU Large ribosomal subunit protein bL21 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q47VL2 1.5e-50 157 74 0 101 3 rplU Large ribosomal subunit protein bL21 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A8H0U2 2.15e-50 157 72 0 101 3 rplU Large ribosomal subunit protein bL21 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TUI0 2.15e-50 157 72 0 101 3 rplU Large ribosomal subunit protein bL21 Shewanella halifaxensis (strain HAW-EB4)
Q9HVL6 2.59e-50 157 69 0 101 1 rplU Large ribosomal subunit protein bL21 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02GA9 2.59e-50 157 69 0 101 3 rplU Large ribosomal subunit protein bL21 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V0B1 2.59e-50 157 69 0 101 3 rplU Large ribosomal subunit protein bL21 Pseudomonas aeruginosa (strain LESB58)
A1RMV8 3.06e-50 157 72 0 101 3 rplU Large ribosomal subunit protein bL21 Shewanella sp. (strain W3-18-1)
A4Y425 3.06e-50 157 72 0 101 3 rplU Large ribosomal subunit protein bL21 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q07YI8 3.12e-50 157 71 0 102 3 rplU Large ribosomal subunit protein bL21 Shewanella frigidimarina (strain NCIMB 400)
B8CSY5 4.06e-50 156 71 0 102 3 rplU Large ribosomal subunit protein bL21 Shewanella piezotolerans (strain WP3 / JCM 13877)
A6VBV5 5.53e-50 156 69 0 101 3 rplU Large ribosomal subunit protein bL21 Pseudomonas aeruginosa (strain PA7)
A8FRU2 7.27e-50 155 72 0 101 3 rplU Large ribosomal subunit protein bL21 Shewanella sediminis (strain HAW-EB3)
C5BQB2 7.43e-50 155 69 0 101 3 rplU Large ribosomal subunit protein bL21 Teredinibacter turnerae (strain ATCC 39867 / T7901)
A1S9H5 9.05e-50 155 71 0 101 3 rplU Large ribosomal subunit protein bL21 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A1TYY2 1.22e-49 155 71 0 101 3 rplU Large ribosomal subunit protein bL21 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q0HRZ6 2.4e-49 154 71 0 101 3 rplU Large ribosomal subunit protein bL21 Shewanella sp. (strain MR-7)
Q0HLU2 2.4e-49 154 71 0 101 3 rplU Large ribosomal subunit protein bL21 Shewanella sp. (strain MR-4)
Q12K21 3.13e-49 154 71 0 101 3 rplU Large ribosomal subunit protein bL21 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A0L074 4.25e-49 154 71 0 101 3 rplU Large ribosomal subunit protein bL21 Shewanella sp. (strain ANA-3)
Q8EB80 4.25e-49 154 71 0 101 3 rplU Large ribosomal subunit protein bL21 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0VSE8 8.39e-49 153 69 0 101 3 rplU Large ribosomal subunit protein bL21 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A6W354 6.76e-47 148 66 0 101 3 rplU Large ribosomal subunit protein bL21 Marinomonas sp. (strain MWYL1)
Q2S9T1 2.38e-46 147 67 0 102 3 rplU Large ribosomal subunit protein bL21 Hahella chejuensis (strain KCTC 2396)
A4XYL4 4.65e-46 146 64 0 101 3 rplU Large ribosomal subunit protein bL21 Pseudomonas mendocina (strain ymp)
B0VEJ4 6.46e-46 145 66 0 102 3 rplU Large ribosomal subunit protein bL21 Acinetobacter baumannii (strain AYE)
A3M8A0 6.46e-46 145 66 0 102 3 rplU Large ribosomal subunit protein bL21 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VSH5 6.46e-46 145 66 0 102 3 rplU Large ribosomal subunit protein bL21 Acinetobacter baumannii (strain SDF)
B2HXU9 6.46e-46 145 66 0 102 3 rplU Large ribosomal subunit protein bL21 Acinetobacter baumannii (strain ACICU)
B7I6V9 6.46e-46 145 66 0 102 1 rplU Large ribosomal subunit protein bL21 Acinetobacter baumannii (strain AB0057)
B7GXH8 6.46e-46 145 66 0 102 3 rplU Large ribosomal subunit protein bL21 Acinetobacter baumannii (strain AB307-0294)
Q6F8G1 6.46e-46 145 67 0 102 3 rplU Large ribosomal subunit protein bL21 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q3K6K7 8.23e-46 145 63 0 101 3 rplU Large ribosomal subunit protein bL21 Pseudomonas fluorescens (strain Pf0-1)
Q4K5T6 8.23e-46 145 63 0 101 3 rplU Large ribosomal subunit protein bL21 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
C1DEA6 2.38e-45 144 65 0 101 3 rplU Large ribosomal subunit protein bL21 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B1JF59 5.41e-45 143 65 0 100 3 rplU Large ribosomal subunit protein bL21 Pseudomonas putida (strain W619)
Q1IF15 8.96e-45 143 64 0 100 3 rplU Large ribosomal subunit protein bL21 Pseudomonas entomophila (strain L48)
Q88Q10 9.06e-45 143 64 0 100 3 rplU Large ribosomal subunit protein bL21 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KMF4 9.06e-45 143 64 0 100 3 rplU Large ribosomal subunit protein bL21 Pseudomonas putida (strain GB-1)
A5VYC4 9.06e-45 143 64 0 100 3 rplU Large ribosomal subunit protein bL21 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q4ZYK3 2.9e-43 139 61 0 101 3 rplU Large ribosomal subunit protein bL21 Pseudomonas syringae pv. syringae (strain B728a)
Q48NL4 2.9e-43 139 61 0 101 3 rplU Large ribosomal subunit protein bL21 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q889F3 4.31e-43 139 60 0 101 3 rplU Large ribosomal subunit protein bL21 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B8GQQ1 8.5e-42 135 61 0 102 3 rplU Large ribosomal subunit protein bL21 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q1LSJ7 9.18e-42 135 55 0 102 3 rplU Large ribosomal subunit protein bL21 Baumannia cicadellinicola subsp. Homalodisca coagulata
B8D7S2 1.56e-40 132 63 0 101 3 rplU Large ribosomal subunit protein bL21 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57467 1.56e-40 132 63 0 101 3 rplU Large ribosomal subunit protein bL21 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9H0 1.56e-40 132 63 0 101 3 rplU Large ribosomal subunit protein bL21 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B0TYK2 5.7e-40 130 60 1 103 3 rplU Large ribosomal subunit protein bL21 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q31IT6 8.84e-40 130 60 1 103 3 rplU Large ribosomal subunit protein bL21 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q8K9G3 1.12e-39 130 58 0 101 3 rplU Large ribosomal subunit protein bL21 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q3SKG4 1.51e-38 127 58 0 101 3 rplU Large ribosomal subunit protein bL21 Thiobacillus denitrificans (strain ATCC 25259)
Q0AAD8 1.69e-38 127 60 0 102 3 rplU Large ribosomal subunit protein bL21 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q0BL02 6.7e-38 125 60 2 104 3 rplU Large ribosomal subunit protein bL21 Francisella tularensis subsp. holarctica (strain OSU18)
A0Q5Q2 6.7e-38 125 60 2 104 3 rplU Large ribosomal subunit protein bL21 Francisella tularensis subsp. novicida (strain U112)
B2SDE8 6.7e-38 125 60 2 104 3 rplU Large ribosomal subunit protein bL21 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A2E4 6.7e-38 125 60 2 104 3 rplU Large ribosomal subunit protein bL21 Francisella tularensis subsp. holarctica (strain LVS)
A7NDG2 6.7e-38 125 60 2 104 3 rplU Large ribosomal subunit protein bL21 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q1Q9X1 7.92e-38 125 56 0 101 3 rplU Large ribosomal subunit protein bL21 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FRD7 7.92e-38 125 56 0 101 3 rplU Large ribosomal subunit protein bL21 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A5WDV0 2.01e-37 124 58 0 101 3 rplU Large ribosomal subunit protein bL21 Psychrobacter sp. (strain PRwf-1)
A4IZ45 8.06e-37 123 59 2 104 3 rplU Large ribosomal subunit protein bL21 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NGR2 8.06e-37 123 59 2 104 3 rplU Large ribosomal subunit protein bL21 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14I64 8.06e-37 123 59 2 104 3 rplU Large ribosomal subunit protein bL21 Francisella tularensis subsp. tularensis (strain FSC 198)
Q89AE8 1.99e-36 122 55 0 101 3 rplU Large ribosomal subunit protein bL21 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B5ELU4 2.26e-36 122 54 0 101 3 rplU Large ribosomal subunit protein bL21 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J429 2.26e-36 122 54 0 101 3 rplU Large ribosomal subunit protein bL21 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q82V18 2.61e-36 121 54 0 102 3 rplU Large ribosomal subunit protein bL21 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q0AHG7 3.21e-36 121 53 0 102 3 rplU Large ribosomal subunit protein bL21 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A1WY50 1.97e-35 119 56 0 102 3 rplU Large ribosomal subunit protein bL21 Halorhodospira halophila (strain DSM 244 / SL1)
Q8PBH2 4.51e-35 118 50 1 102 3 rplU Large ribosomal subunit protein bL21 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RY34 4.51e-35 118 50 1 102 3 rplU Large ribosomal subunit protein bL21 Xanthomonas campestris pv. campestris (strain B100)
Q4US34 4.51e-35 118 50 1 102 3 rplU Large ribosomal subunit protein bL21 Xanthomonas campestris pv. campestris (strain 8004)
Q83EE0 7.81e-35 118 56 0 102 3 rplU Large ribosomal subunit protein bL21 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NBL3 7.81e-35 118 56 0 102 3 rplU Large ribosomal subunit protein bL21 Coxiella burnetii (strain RSA 331 / Henzerling II)
A1KAC8 1.05e-34 117 52 0 102 3 rplU Large ribosomal subunit protein bL21 Azoarcus sp. (strain BH72)
Q47AD2 1.21e-34 117 53 0 102 3 rplU Large ribosomal subunit protein bL21 Dechloromonas aromatica (strain RCB)
A9KEJ9 1.26e-34 117 55 0 102 3 rplU Large ribosomal subunit protein bL21 Coxiella burnetii (strain Dugway 5J108-111)
Q2Y809 1.52e-34 117 51 0 102 3 rplU Large ribosomal subunit protein bL21 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q493U7 1.7e-34 117 51 0 101 3 rplU Large ribosomal subunit protein bL21 Blochmanniella pennsylvanica (strain BPEN)
Q5H2E7 2.43e-34 117 51 1 102 3 rplU Large ribosomal subunit protein bL21 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P5B6 2.43e-34 117 51 1 102 3 rplU Large ribosomal subunit protein bL21 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A1KVV8 2.72e-34 116 50 0 102 3 rplU Large ribosomal subunit protein bL21 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q7DDR4 2.72e-34 116 50 0 102 3 rplU Large ribosomal subunit protein bL21 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JRF6 2.72e-34 116 50 0 102 3 rplU Large ribosomal subunit protein bL21 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q5F686 3.01e-34 116 50 0 102 3 rplU Large ribosomal subunit protein bL21 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q3BW48 3.45e-34 116 50 1 102 3 rplU Large ribosomal subunit protein bL21 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PN25 3.45e-34 116 50 1 102 3 rplU Large ribosomal subunit protein bL21 Xanthomonas axonopodis pv. citri (strain 306)
Q1GZ51 8.08e-34 115 51 0 102 3 rplU Large ribosomal subunit protein bL21 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q5P7Z6 1.89e-33 114 51 0 102 3 rplU Large ribosomal subunit protein bL21 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B2FTD1 2.21e-33 114 48 1 102 3 rplU Large ribosomal subunit protein bL21 Stenotrophomonas maltophilia (strain K279a)
A1AXH5 2.62e-33 114 49 0 101 3 rplU Large ribosomal subunit protein bL21 Ruthia magnifica subsp. Calyptogena magnifica
B4SP12 3.1e-33 114 49 1 102 3 rplU Large ribosomal subunit protein bL21 Stenotrophomonas maltophilia (strain R551-3)
A9BP70 3.52e-33 114 51 0 102 3 rplU Large ribosomal subunit protein bL21 Delftia acidovorans (strain DSM 14801 / SPH-1)
A1W4A8 3.6e-33 114 50 0 102 3 rplU Large ribosomal subunit protein bL21 Acidovorax sp. (strain JS42)
A5CVV9 4.19e-33 113 49 0 101 3 rplU Large ribosomal subunit protein bL21 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
B9MDZ5 4.73e-33 113 50 0 102 3 rplU Large ribosomal subunit protein bL21 Acidovorax ebreus (strain TPSY)
Q5WTE9 1.1e-32 112 50 0 101 3 rplU Large ribosomal subunit protein bL21 Legionella pneumophila (strain Lens)
B8FM66 3.02e-32 111 51 0 101 3 rplU Large ribosomal subunit protein bL21 Desulfatibacillum aliphaticivorans
A1TTD5 4.98e-32 110 49 0 102 3 rplU Large ribosomal subunit protein bL21 Paracidovorax citrulli (strain AAC00-1)
A1WPR7 5.2e-32 110 50 0 102 3 rplU Large ribosomal subunit protein bL21 Verminephrobacter eiseniae (strain EF01-2)
Q5ZS68 5.68e-32 110 49 0 101 3 rplU Large ribosomal subunit protein bL21 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IAS5 5.68e-32 110 49 0 101 3 rplU Large ribosomal subunit protein bL21 Legionella pneumophila (strain Corby)
Q5X1N9 5.68e-32 110 49 0 101 3 rplU Large ribosomal subunit protein bL21 Legionella pneumophila (strain Paris)
Q0AWJ0 1.2e-31 110 49 1 102 3 rplU Large ribosomal subunit protein bL21 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q9PAS1 1.28e-31 110 49 1 102 3 rplU Large ribosomal subunit protein bL21 Xylella fastidiosa (strain 9a5c)
Q8XVK8 1.33e-31 109 48 0 101 3 rplU Large ribosomal subunit protein bL21 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q7VZX4 1.75e-31 109 49 0 102 3 rplU Large ribosomal subunit protein bL21 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W1P0 1.75e-31 109 49 0 102 3 rplU Large ribosomal subunit protein bL21 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WQL6 1.75e-31 109 49 0 102 3 rplU Large ribosomal subunit protein bL21 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q605N4 2.25e-31 109 51 0 102 3 rplU Large ribosomal subunit protein bL21 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
C5CXX5 3.53e-31 108 49 0 102 3 rplU Large ribosomal subunit protein bL21 Variovorax paradoxus (strain S110)
A2SD34 3.69e-31 108 47 0 101 3 rplU Large ribosomal subunit protein bL21 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q7NZS3 3.77e-31 108 47 0 102 3 rplU Large ribosomal subunit protein bL21 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q2L058 4.69e-31 108 48 0 101 3 rplU Large ribosomal subunit protein bL21 Bordetella avium (strain 197N)
A9IFF5 5.18e-31 108 48 0 101 3 rplU Large ribosomal subunit protein bL21 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q049M4 5.41e-31 108 48 0 101 3 rplU Large ribosomal subunit protein bL21 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1G9G5 5.41e-31 108 48 0 101 3 rplU Large ribosomal subunit protein bL21 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
A5EVQ9 5.9e-31 108 49 0 101 3 rplU Large ribosomal subunit protein bL21 Dichelobacter nodosus (strain VCS1703A)
Q87BL0 7.67e-31 108 49 1 102 3 rplU Large ribosomal subunit protein bL21 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q3J6S2 8.08e-31 107 54 0 102 3 rplU Large ribosomal subunit protein bL21 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
B2UCV5 9.05e-31 107 47 0 101 3 rplU Large ribosomal subunit protein bL21 Ralstonia pickettii (strain 12J)
A4G8R6 1.07e-30 107 50 0 101 3 rplU Large ribosomal subunit protein bL21 Herminiimonas arsenicoxydans
C1D504 1.14e-30 107 47 0 102 3 rplU Large ribosomal subunit protein bL21 Laribacter hongkongensis (strain HLHK9)
B1Y282 1.46e-30 107 46 0 101 3 rplU Large ribosomal subunit protein bL21 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
B2A6B3 1.97e-30 107 46 0 101 3 rplU Large ribosomal subunit protein bL21 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
C6BZ96 1.99e-30 107 49 0 101 3 rplU Large ribosomal subunit protein bL21 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
B9IZ20 5.29e-30 105 49 1 101 3 rplU Large ribosomal subunit protein bL21 Bacillus cereus (strain Q1)
A7GTC4 5.29e-30 105 49 1 101 3 rplU Large ribosomal subunit protein bL21 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B7HQK2 5.29e-30 105 49 1 101 3 rplU Large ribosomal subunit protein bL21 Bacillus cereus (strain AH187)
Q72ZY1 5.29e-30 105 49 1 101 3 rplU Large ribosomal subunit protein bL21 Bacillus cereus (strain ATCC 10987 / NRS 248)
A6T2D7 6.14e-30 105 49 0 101 3 rplU Large ribosomal subunit protein bL21 Janthinobacterium sp. (strain Marseille)
Q21Z01 6.56e-30 105 45 0 102 3 rplU Large ribosomal subunit protein bL21 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B9JEQ7 7.75e-30 105 49 0 101 3 rplU Large ribosomal subunit protein bL21 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
B2V0A5 7.81e-30 105 49 0 101 3 rplU Large ribosomal subunit protein bL21 Clostridium botulinum (strain Alaska E43 / Type E3)
Q46X15 8.81e-30 105 47 0 101 3 rplU Large ribosomal subunit protein bL21 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
B3R8A0 1.03e-29 105 47 0 101 3 rplU Large ribosomal subunit protein bL21 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0K6P4 1.03e-29 105 47 0 101 3 rplU Large ribosomal subunit protein bL21 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q8REI5 1.57e-29 104 46 1 102 3 rplU Large ribosomal subunit protein bL21 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q5FJF9 1.72e-29 104 46 0 101 3 rplU Large ribosomal subunit protein bL21 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q1LIP8 1.76e-29 104 47 0 101 3 rplU Large ribosomal subunit protein bL21 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A9VIR9 2.19e-29 104 48 1 101 3 rplU Large ribosomal subunit protein bL21 Bacillus mycoides (strain KBAB4)
Q6HD81 2.19e-29 104 48 1 101 3 rplU Large ribosomal subunit protein bL21 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q633Z9 2.19e-29 104 48 1 101 3 rplU Large ribosomal subunit protein bL21 Bacillus cereus (strain ZK / E33L)
Q817U2 2.19e-29 104 48 1 101 3 rplU Large ribosomal subunit protein bL21 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HE77 2.19e-29 104 48 1 101 3 rplU Large ribosomal subunit protein bL21 Bacillus cereus (strain B4264)
C1ETP1 2.19e-29 104 48 1 101 3 rplU Large ribosomal subunit protein bL21 Bacillus cereus (strain 03BB102)
B7IIV6 2.19e-29 104 48 1 101 3 rplU Large ribosomal subunit protein bL21 Bacillus cereus (strain G9842)
B7JQ30 2.19e-29 104 48 1 101 3 rplU Large ribosomal subunit protein bL21 Bacillus cereus (strain AH820)
Q81LE6 2.19e-29 104 48 1 101 3 rplU Large ribosomal subunit protein bL21 Bacillus anthracis
A0RJ51 2.19e-29 104 48 1 101 3 rplU Large ribosomal subunit protein bL21 Bacillus thuringiensis (strain Al Hakam)
C3L6X6 2.19e-29 104 48 1 101 3 rplU Large ribosomal subunit protein bL21 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P9D0 2.19e-29 104 48 1 101 3 rplU Large ribosomal subunit protein bL21 Bacillus anthracis (strain A0248)
A1VK92 3.24e-29 103 46 0 101 3 rplU Large ribosomal subunit protein bL21 Polaromonas naphthalenivorans (strain CJ2)
A8YVX7 4.12e-29 103 45 0 101 3 rplU Large ribosomal subunit protein bL21 Lactobacillus helveticus (strain DPC 4571)
Q3A1D6 5.44e-29 103 49 1 101 3 rplU Large ribosomal subunit protein bL21 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q12F97 5.85e-29 103 46 0 101 3 rplU Large ribosomal subunit protein bL21 Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q7VQN2 6.56e-29 103 47 0 101 3 rplU Large ribosomal subunit protein bL21 Blochmanniella floridana
A8F8P9 8.43e-29 102 45 0 101 3 rplU Large ribosomal subunit protein bL21 Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
B2TK75 8.58e-29 102 48 0 101 3 rplU Large ribosomal subunit protein bL21 Clostridium botulinum (strain Eklund 17B / Type B)
Q9K8J5 9e-29 102 49 1 101 3 rplU Large ribosomal subunit protein bL21 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A1VF58 9.82e-29 102 53 1 101 3 rplU Large ribosomal subunit protein bL21 Nitratidesulfovibrio vulgaris (strain DP4)
Q72DK2 9.82e-29 102 53 1 101 3 rplU Large ribosomal subunit protein bL21 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A5N6J9 1.15e-28 102 47 0 101 3 rplU Large ribosomal subunit protein bL21 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E018 1.15e-28 102 47 0 101 3 rplU Large ribosomal subunit protein bL21 Clostridium kluyveri (strain NBRC 12016)
B3E331 1.64e-28 102 49 1 102 3 rplU Large ribosomal subunit protein bL21 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
A6UDV2 2.11e-28 102 49 0 101 3 rplU Large ribosomal subunit protein bL21 Sinorhizobium medicae (strain WSM419)
A4SVA1 2.17e-28 101 46 0 101 3 rplU Large ribosomal subunit protein bL21 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
C4Z9Z6 2.84e-28 101 50 1 98 3 rplU Large ribosomal subunit protein bL21 Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
C4Z0A5 3.94e-28 100 50 1 98 3 rplU Large ribosomal subunit protein bL21 Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
B3PRY8 4.53e-28 100 47 0 101 3 rplU Large ribosomal subunit protein bL21 Rhizobium etli (strain CIAT 652)
B0S3Z1 5.35e-28 100 52 1 101 3 rplU Large ribosomal subunit protein bL21 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
B8J4L5 8.75e-28 100 49 1 101 3 rplU Large ribosomal subunit protein bL21 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q24SN7 1.1e-27 100 47 0 101 3 rplU Large ribosomal subunit protein bL21 Desulfitobacterium hafniense (strain Y51)
B8FUS3 1.1e-27 100 47 0 101 3 rplU Large ribosomal subunit protein bL21 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q2RL02 1.17e-27 100 46 0 101 3 rplU Large ribosomal subunit protein bL21 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q8UBR5 1.2e-27 99 48 0 101 3 rplU Large ribosomal subunit protein bL21 Agrobacterium fabrum (strain C58 / ATCC 33970)
B1XT33 1.28e-27 99 45 0 101 3 rplU Large ribosomal subunit protein bL21 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q67SC9 1.48e-27 99 45 0 100 3 rplU Large ribosomal subunit protein bL21 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B9E724 1.53e-27 99 47 1 101 3 rplU Large ribosomal subunit protein bL21 Macrococcus caseolyticus (strain JCSC5402)
A4IRD1 1.82e-27 99 50 1 101 3 rplU Large ribosomal subunit protein bL21 Geobacillus thermodenitrificans (strain NG80-2)
Q2K2Y1 2.07e-27 99 46 0 101 3 rplU Large ribosomal subunit protein bL21 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
A4JBB6 2.31e-27 99 46 0 101 3 rplU Large ribosomal subunit protein bL21 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q1BZE2 2.31e-27 99 46 0 101 3 rplU Large ribosomal subunit protein bL21 Burkholderia orbicola (strain AU 1054)
B1JV99 2.31e-27 99 46 0 101 3 rplU Large ribosomal subunit protein bL21 Burkholderia orbicola (strain MC0-3)
A9AI62 2.31e-27 99 46 0 101 3 rplU Large ribosomal subunit protein bL21 Burkholderia multivorans (strain ATCC 17616 / 249)
Q39JU9 2.31e-27 99 46 0 101 3 rplU Large ribosomal subunit protein bL21 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BII0 2.31e-27 99 46 0 101 3 rplU Large ribosomal subunit protein bL21 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B4E5X2 2.31e-27 99 46 0 101 3 rplU Large ribosomal subunit protein bL21 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K4A8 2.31e-27 99 46 0 101 3 rplU Large ribosomal subunit protein bL21 Burkholderia cenocepacia (strain HI2424)
B1YSU5 2.31e-27 99 46 0 101 3 rplU Large ribosomal subunit protein bL21 Burkholderia ambifaria (strain MC40-6)
B5ZUD8 2.34e-27 99 46 0 101 3 rplU Large ribosomal subunit protein bL21 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q1MA81 2.34e-27 99 46 0 101 3 rplU Large ribosomal subunit protein bL21 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B0TBW7 2.44e-27 99 43 0 101 3 rplU Large ribosomal subunit protein bL21 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
B9JUI4 2.45e-27 99 48 0 101 3 rplU Large ribosomal subunit protein bL21 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
C5CDH9 2.53e-27 99 48 1 102 3 rplU Large ribosomal subunit protein bL21 Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
Q057J2 2.63e-27 99 45 0 101 3 rplU Large ribosomal subunit protein bL21 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
B6IR01 2.87e-27 99 47 0 101 3 rplU Large ribosomal subunit protein bL21 Rhodospirillum centenum (strain ATCC 51521 / SW)
C5D5G9 2.88e-27 99 50 1 101 3 rplU Large ribosomal subunit protein bL21 Geobacillus sp. (strain WCH70)
Q5KWP1 2.88e-27 99 50 1 101 3 rplU Large ribosomal subunit protein bL21 Geobacillus kaustophilus (strain HTA426)
Q65GM3 3.47e-27 98 49 1 101 3 rplU Large ribosomal subunit protein bL21 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q0SR51 3.61e-27 98 46 0 101 3 rplU Large ribosomal subunit protein bL21 Clostridium perfringens (strain SM101 / Type A)
Q8XII9 3.61e-27 98 46 0 101 3 rplU Large ribosomal subunit protein bL21 Clostridium perfringens (strain 13 / Type A)
Q0TNI2 3.61e-27 98 46 0 101 3 rplU Large ribosomal subunit protein bL21 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q2VZU4 4.27e-27 98 50 1 102 3 rplU Large ribosomal subunit protein bL21 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q3ZYN5 4.32e-27 99 41 0 98 3 rplU Large ribosomal subunit protein bL21 Dehalococcoides mccartyi (strain CBDB1)
Q2SZG2 7.43e-27 97 45 0 101 3 rplU Large ribosomal subunit protein bL21 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q9FD29 7.43e-27 97 45 0 101 3 rplU Large ribosomal subunit protein bL21 Burkholderia pseudomallei (strain K96243)
A3NDT0 7.43e-27 97 45 0 101 3 rplU Large ribosomal subunit protein bL21 Burkholderia pseudomallei (strain 668)
A3NZJ2 7.43e-27 97 45 0 101 3 rplU Large ribosomal subunit protein bL21 Burkholderia pseudomallei (strain 1106a)
A1V0P3 7.43e-27 97 45 0 101 3 rplU Large ribosomal subunit protein bL21 Burkholderia mallei (strain SAVP1)
Q62GV2 7.43e-27 97 45 0 101 3 rplU Large ribosomal subunit protein bL21 Burkholderia mallei (strain ATCC 23344)
A2S5S0 7.43e-27 97 45 0 101 3 rplU Large ribosomal subunit protein bL21 Burkholderia mallei (strain NCTC 10229)
A3MR88 7.43e-27 97 45 0 101 3 rplU Large ribosomal subunit protein bL21 Burkholderia mallei (strain NCTC 10247)
B8DRP1 8.89e-27 97 51 1 101 3 rplU Large ribosomal subunit protein bL21 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
B0K418 9.51e-27 97 41 1 102 3 rplU Large ribosomal subunit protein bL21 Thermoanaerobacter sp. (strain X514)
B0KAC2 9.51e-27 97 41 1 102 3 rplU Large ribosomal subunit protein bL21 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B5YJ67 9.61e-27 97 46 0 101 3 rplU Large ribosomal subunit protein bL21 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
C4L4N1 1.01e-26 97 49 1 101 3 rplU Large ribosomal subunit protein bL21 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
A6LQR6 1.39e-26 97 45 0 101 3 rplU Large ribosomal subunit protein bL21 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q3Z6W3 1.45e-26 98 41 0 98 3 rplU Large ribosomal subunit protein bL21 Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
C0QLE7 1.72e-26 97 44 0 101 3 rplU Large ribosomal subunit protein bL21 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
A0LPF7 2.44e-26 96 46 0 101 3 rplU Large ribosomal subunit protein bL21 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
A9NF54 2.52e-26 96 47 1 101 3 rplU Large ribosomal subunit protein bL21 Acholeplasma laidlawii (strain PG-8A)
B1YJS3 2.6e-26 96 46 1 101 3 rplU Large ribosomal subunit protein bL21 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q74IL4 2.94e-26 96 45 0 101 3 rplU Large ribosomal subunit protein bL21 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
B2JHD9 3.36e-26 96 45 0 101 3 rplU Large ribosomal subunit protein bL21 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q13U13 3.66e-26 96 45 0 101 3 rplU Large ribosomal subunit protein bL21 Paraburkholderia xenovorans (strain LB400)
B2SYV4 3.66e-26 96 45 0 101 3 rplU Large ribosomal subunit protein bL21 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q5WES3 4.34e-26 95 50 1 98 3 rplU Large ribosomal subunit protein bL21 Shouchella clausii (strain KSM-K16)
Q8RBA9 5.35e-26 95 41 1 102 3 rplU Large ribosomal subunit protein bL21 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A9KMF8 7.41e-26 95 43 1 101 3 rplU Large ribosomal subunit protein bL21 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q7VK82 7.67e-26 95 44 0 101 3 rplU Large ribosomal subunit protein bL21 Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q2LR75 8.14e-26 95 47 0 102 3 rplU Large ribosomal subunit protein bL21 Syntrophus aciditrophicus (strain SB)
A6Q4D4 1.19e-25 94 48 1 101 3 rplU Large ribosomal subunit protein bL21 Nitratiruptor sp. (strain SB155-2)
Q9CGL7 1.61e-25 94 44 1 100 3 rplU Large ribosomal subunit protein bL21 Lactococcus lactis subsp. lactis (strain IL1403)
Q892N4 1.78e-25 94 44 2 103 3 rplU Large ribosomal subunit protein bL21 Clostridium tetani (strain Massachusetts / E88)
A8FFT2 1.9e-25 94 47 1 101 3 rplU Large ribosomal subunit protein bL21 Bacillus pumilus (strain SAFR-032)
Q02ZA8 2.58e-25 94 44 1 100 3 rplU Large ribosomal subunit protein bL21 Lactococcus lactis subsp. cremoris (strain SK11)
A2RLA4 2.58e-25 94 44 1 100 1 rplU Large ribosomal subunit protein bL21 Lactococcus lactis subsp. cremoris (strain MG1363)
Q7UFG2 2.72e-25 94 46 0 102 3 rplU Large ribosomal subunit protein bL21 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q92LB8 3.15e-25 94 46 0 101 3 rplU Large ribosomal subunit protein bL21 Rhizobium meliloti (strain 1021)
P26908 3.5e-25 93 46 1 101 1 rplU Large ribosomal subunit protein bL21 Bacillus subtilis (strain 168)
C3M9X5 6.05e-25 93 46 0 101 3 rplU Large ribosomal subunit protein bL21 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A6TQJ2 6.28e-25 92 43 0 101 3 rplU Large ribosomal subunit protein bL21 Alkaliphilus metalliredigens (strain QYMF)
Q18B24 6.42e-25 92 39 0 101 3 rplU Large ribosomal subunit protein bL21 Clostridioides difficile (strain 630)
Q03G01 6.66e-25 92 47 1 101 3 rplU Large ribosomal subunit protein bL21 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
A5D407 7.08e-25 92 45 0 101 3 rplU Large ribosomal subunit protein bL21 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
B5E956 7.19e-25 92 46 1 101 3 rplU Large ribosomal subunit protein bL21 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q9PQT0 7.51e-25 92 42 1 102 3 rplU Large ribosomal subunit protein bL21 Ureaplasma parvum serovar 3 (strain ATCC 700970)
B1AIK0 7.51e-25 92 42 1 102 3 rplU Large ribosomal subunit protein bL21 Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736)
A5I669 7.69e-25 92 45 2 103 3 rplU Large ribosomal subunit protein bL21 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FXU9 7.69e-25 92 45 2 103 3 rplU Large ribosomal subunit protein bL21 Clostridium botulinum (strain ATCC 19397 / Type A)
Q30XV8 8.03e-25 92 47 1 101 3 rplU Large ribosomal subunit protein bL21 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A3DBS2 8.71e-25 92 41 0 101 3 rplU Large ribosomal subunit protein bL21 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q3AF54 1.03e-24 92 45 0 96 3 rplU Large ribosomal subunit protein bL21 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q4FP48 1.06e-24 93 41 1 101 3 rplU Large ribosomal subunit protein bL21 Pelagibacter ubique (strain HTCC1062)
A8MHL1 1.07e-24 92 43 0 101 3 rplU Large ribosomal subunit protein bL21 Alkaliphilus oremlandii (strain OhILAs)
A0Q1T8 1.08e-24 92 44 0 101 3 rplU Large ribosomal subunit protein bL21 Clostridium novyi (strain NT)
B5ZB20 1.11e-24 92 42 1 102 3 rplU Large ribosomal subunit protein bL21 Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western)
A5IMC7 1.2e-24 92 42 1 102 3 rplU Large ribosomal subunit protein bL21 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
B1KZR6 1.23e-24 92 44 2 103 3 rplU Large ribosomal subunit protein bL21 Clostridium botulinum (strain Loch Maree / Type A3)
A7GHK5 1.23e-24 92 44 2 103 3 rplU Large ribosomal subunit protein bL21 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1ILY8 1.23e-24 92 44 2 103 3 rplU Large ribosomal subunit protein bL21 Clostridium botulinum (strain Okra / Type B1)
C3L3J6 1.23e-24 92 44 2 103 3 rplU Large ribosomal subunit protein bL21 Clostridium botulinum (strain 657 / Type Ba4)
B1HVB6 1.43e-24 92 44 1 101 3 rplU Large ribosomal subunit protein bL21 Lysinibacillus sphaericus (strain C3-41)
Q5FUL4 1.45e-24 92 44 0 101 3 rplU Large ribosomal subunit protein bL21 Gluconobacter oxydans (strain 621H)
A9FG66 1.5e-24 92 52 1 101 3 rplU Large ribosomal subunit protein bL21 Sorangium cellulosum (strain So ce56)
Q2RV02 1.56e-24 92 43 1 102 3 rplU Large ribosomal subunit protein bL21 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
A5GD27 1.74e-24 91 47 1 101 3 rplU Large ribosomal subunit protein bL21 Geotalea uraniireducens (strain Rf4)
B1VAF5 2.19e-24 91 47 1 101 3 rplU Large ribosomal subunit protein bL21 Phytoplasma australiense
B8G6X1 2.33e-24 91 39 0 101 3 rplU Large ribosomal subunit protein bL21 Chloroflexus aggregans (strain MD-66 / DSM 9485)
C1FVW8 2.42e-24 91 43 1 102 3 rplU Large ribosomal subunit protein bL21 Clostridium botulinum (strain Kyoto / Type A2)
P60492 2.74e-24 91 45 1 98 1 rplU Large ribosomal subunit protein bL21 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72HR2 2.74e-24 91 45 1 98 1 rplU Large ribosomal subunit protein bL21 Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
B1LBJ6 2.91e-24 91 41 1 102 3 rplU Large ribosomal subunit protein bL21 Thermotoga sp. (strain RQ2)
C0ZAL3 3.06e-24 91 43 0 101 3 rplU Large ribosomal subunit protein bL21 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q9X1G9 3.57e-24 91 41 1 102 3 rplU Large ribosomal subunit protein bL21 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q836X6 3.74e-24 90 43 1 101 1 rplU Large ribosomal subunit protein bL21 Enterococcus faecalis (strain ATCC 700802 / V583)
A9H0E5 4.09e-24 90 44 0 101 3 rplU Large ribosomal subunit protein bL21 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
C6E8U1 4.71e-24 90 45 1 101 3 rplU Large ribosomal subunit protein bL21 Geobacter sp. (strain M21)
B5YEQ3 4.79e-24 90 42 0 102 3 rplU Large ribosomal subunit protein bL21 Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
B2G858 5.49e-24 90 44 1 101 3 rplU Large ribosomal subunit protein bL21 Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VKS5 5.49e-24 90 44 1 101 3 rplU Large ribosomal subunit protein bL21 Limosilactobacillus reuteri (strain DSM 20016)
C4XNW0 6.68e-24 90 45 1 101 3 rplU Large ribosomal subunit protein bL21 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
B9M3W1 8.13e-24 90 46 1 101 3 rplU Large ribosomal subunit protein bL21 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q1GHD3 8.32e-24 92 53 4 103 3 rplU Large ribosomal subunit protein bL21 Ruegeria sp. (strain TM1040)
Q8EPP6 8.68e-24 90 43 1 101 3 rplU Large ribosomal subunit protein bL21 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B1I4P8 1.09e-23 89 45 0 101 3 rplU Large ribosomal subunit protein bL21 Desulforudis audaxviator (strain MP104C)
Q0BZ42 1.14e-23 92 45 0 101 3 rplU Large ribosomal subunit protein bL21 Hyphomonas neptunium (strain ATCC 15444)
Q8NN50 1.22e-23 89 41 1 101 3 rplU Large ribosomal subunit protein bL21 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QG85 1.22e-23 89 41 1 101 3 rplU Large ribosomal subunit protein bL21 Corynebacterium glutamicum (strain R)
A7Z785 1.3e-23 89 44 1 101 3 rplU Large ribosomal subunit protein bL21 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q38XV5 1.52e-23 89 43 1 101 3 rplU Large ribosomal subunit protein bL21 Latilactobacillus sakei subsp. sakei (strain 23K)
Q0BRF1 1.62e-23 89 42 0 98 3 rplU Large ribosomal subunit protein bL21 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q747M9 1.91e-23 89 47 1 101 3 rplU Large ribosomal subunit protein bL21 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A7HT70 1.94e-23 89 42 0 102 3 rplU Large ribosomal subunit protein bL21 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q8FN76 1.98e-23 89 41 1 101 3 rplU Large ribosomal subunit protein bL21 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P95756 2.53e-23 89 42 2 102 3 rplU Large ribosomal subunit protein bL21 Streptomyces griseus
B1VXD6 2.53e-23 89 42 2 102 3 rplU Large ribosomal subunit protein bL21 Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
B8HUY7 3e-23 89 41 0 100 3 rplU Large ribosomal subunit protein bL21 Cyanothece sp. (strain PCC 7425 / ATCC 29141)
C5CAZ3 3.46e-23 88 44 2 102 3 rplU Large ribosomal subunit protein bL21 Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / CCM 169 / CCUG 5858 / IAM 1056 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
B8I176 3.57e-23 88 44 0 101 3 rplU Large ribosomal subunit protein bL21 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
A1AKW3 3.75e-23 88 46 1 102 3 rplU Large ribosomal subunit protein bL21 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B2IE47 4.12e-23 88 44 0 101 3 rplU Large ribosomal subunit protein bL21 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
B3EUD6 4.59e-23 88 41 0 101 3 rplU Large ribosomal subunit protein bL21 Amoebophilus asiaticus (strain 5a2)
B2GD73 5.04e-23 88 42 1 101 3 rplU Large ribosomal subunit protein bL21 Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
B8E0B4 5.41e-23 88 42 0 102 3 rplU Large ribosomal subunit protein bL21 Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
A5FV27 7.46e-23 87 40 0 101 3 rplU Large ribosomal subunit protein bL21 Acidiphilium cryptum (strain JF-5)
A8M0Z1 8.32e-23 87 42 1 102 3 rplU Large ribosomal subunit protein bL21 Salinispora arenicola (strain CNS-205)
P56046 9.28e-23 87 47 0 100 3 rplU Large ribosomal subunit protein bL21 Helicobacter pylori (strain ATCC 700392 / 26695)
B2USC7 9.28e-23 87 47 0 100 3 rplU Large ribosomal subunit protein bL21 Helicobacter pylori (strain Shi470)
B9LJ76 9.65e-23 87 36 0 101 3 rplU Large ribosomal subunit protein bL21 Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WGJ5 9.65e-23 87 36 0 101 3 rplU Large ribosomal subunit protein bL21 Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q1CUK7 1.02e-22 87 47 0 100 3 rplU Large ribosomal subunit protein bL21 Helicobacter pylori (strain HPAG1)
Q824F5 1.25e-22 87 38 1 101 3 rplU Large ribosomal subunit protein bL21 Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
A8ZRX9 1.5e-22 87 46 0 101 3 rplU Large ribosomal subunit protein bL21 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q7MA30 1.65e-22 87 41 0 102 3 rplU Large ribosomal subunit protein bL21 Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q8FYL7 1.71e-22 87 44 1 101 3 rplU Large ribosomal subunit protein bL21 Brucella suis biovar 1 (strain 1330)
A9WWX3 1.71e-22 87 44 1 101 3 rplU Large ribosomal subunit protein bL21 Brucella suis (strain ATCC 23445 / NCTC 10510)
Q8YJ85 1.71e-22 87 44 1 101 3 rplU Large ribosomal subunit protein bL21 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RF98 1.71e-22 87 44 1 101 3 rplU Large ribosomal subunit protein bL21 Brucella melitensis biotype 2 (strain ATCC 23457)
A6LLU6 1.77e-22 87 42 2 103 3 rplU Large ribosomal subunit protein bL21 Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Q165Y2 1.92e-22 89 47 2 102 3 rplU Large ribosomal subunit protein bL21 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q1MQQ0 2.04e-22 86 43 1 101 3 rplU Large ribosomal subunit protein bL21 Lawsonia intracellularis (strain PHE/MN1-00)
O87886 2.04e-22 86 43 1 101 3 rplU Large ribosomal subunit protein bL21 Lawsonia intracellularis
Q0AKX7 2.06e-22 89 40 0 101 3 rplU Large ribosomal subunit protein bL21 Maricaulis maris (strain MCS10)
A9BHC0 2.2e-22 86 43 1 102 3 rplU Large ribosomal subunit protein bL21 Petrotoga mobilis (strain DSM 10674 / SJ95)
A1B9H5 2.56e-22 87 43 2 102 3 rplU Large ribosomal subunit protein bL21 Paracoccus denitrificans (strain Pd 1222)
Q8VW57 3.04e-22 87 44 1 101 3 rplU Large ribosomal subunit protein bL21 Brucella abortus biovar 1 (strain 9-941)
Q2YLL7 3.04e-22 87 44 1 101 3 rplU Large ribosomal subunit protein bL21 Brucella abortus (strain 2308)
B2S811 3.04e-22 87 44 1 101 3 rplU Large ribosomal subunit protein bL21 Brucella abortus (strain S19)
A6QB72 3.1e-22 86 44 1 102 3 rplU Large ribosomal subunit protein bL21 Sulfurovum sp. (strain NBC37-1)
A4XAG3 3.29e-22 86 41 1 102 3 rplU Large ribosomal subunit protein bL21 Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
Q5L6S1 3.33e-22 86 39 1 101 3 rplU Large ribosomal subunit protein bL21 Chlamydia abortus (strain DSM 27085 / S26/3)
A3PQI7 3.38e-22 87 40 2 102 3 rplU Large ribosomal subunit protein bL21 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
B9KW01 3.93e-22 86 40 2 102 3 rplU Large ribosomal subunit protein bL21 Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3IXY2 3.93e-22 86 40 2 102 3 rplU Large ribosomal subunit protein bL21 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q82C87 4.72e-22 85 42 2 102 3 rplU Large ribosomal subunit protein bL21 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
B6JKM5 4.88e-22 85 46 0 100 3 rplU Large ribosomal subunit protein bL21 Helicobacter pylori (strain P12)
A0RR39 5.21e-22 85 43 1 101 3 rplU Large ribosomal subunit protein bL21 Campylobacter fetus subsp. fetus (strain 82-40)
B5ZA62 5.81e-22 85 46 0 100 3 rplU Large ribosomal subunit protein bL21 Helicobacter pylori (strain G27)
C3PI05 5.97e-22 85 41 1 101 3 rplU Large ribosomal subunit protein bL21 Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q9ABB2 6.63e-22 87 41 0 102 3 rplU Large ribosomal subunit protein bL21 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B3CV07 6.69e-22 85 41 2 105 3 rplU Large ribosomal subunit protein bL21 Orientia tsutsugamushi (strain Ikeda)
A4XJS5 7.34e-22 85 35 0 102 3 rplU Large ribosomal subunit protein bL21 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q8Y6Y9 8.06e-22 85 42 1 101 1 rplU Large ribosomal subunit protein bL21 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DHK6 8.06e-22 85 42 1 101 3 rplU Large ribosomal subunit protein bL21 Listeria monocytogenes serotype 4a (strain HCC23)
Q71ZC8 8.06e-22 85 42 1 101 3 rplU Large ribosomal subunit protein bL21 Listeria monocytogenes serotype 4b (strain F2365)
B7ICN4 8.6e-22 85 43 2 103 3 rplU Large ribosomal subunit protein bL21 Thermosipho africanus (strain TCF52B)
Q1WTI0 8.6e-22 85 43 1 101 3 rplU Large ribosomal subunit protein bL21 Ligilactobacillus salivarius (strain UCC118)
Q30QN8 1.04e-21 84 43 1 102 3 rplU Large ribosomal subunit protein bL21 Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q7A0Q2 1.09e-21 84 46 1 98 3 rplU Large ribosomal subunit protein bL21 Staphylococcus aureus (strain MW2)
Q93EP0 1.09e-21 84 46 1 98 3 rplU Large ribosomal subunit protein bL21 Staphylococcus aureus
A8Z2H5 1.09e-21 84 46 1 98 3 rplU Large ribosomal subunit protein bL21 Staphylococcus aureus (strain USA300 / TCH1516)
Q6G8S2 1.09e-21 84 46 1 98 3 rplU Large ribosomal subunit protein bL21 Staphylococcus aureus (strain MSSA476)
Q6GG57 1.09e-21 84 46 1 98 3 rplU Large ribosomal subunit protein bL21 Staphylococcus aureus (strain MRSA252)
Q7A583 1.09e-21 84 46 1 98 1 rplU Large ribosomal subunit protein bL21 Staphylococcus aureus (strain N315)
Q99TK6 1.09e-21 84 46 1 98 3 rplU Large ribosomal subunit protein bL21 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QHI9 1.09e-21 84 46 1 98 3 rplU Large ribosomal subunit protein bL21 Staphylococcus aureus (strain Newman)
Q5HFB6 1.09e-21 84 46 1 98 3 rplU Large ribosomal subunit protein bL21 Staphylococcus aureus (strain COL)
Q2YT83 1.09e-21 84 46 1 98 1 rplU Large ribosomal subunit protein bL21 Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5ITH1 1.09e-21 84 46 1 98 3 rplU Large ribosomal subunit protein bL21 Staphylococcus aureus (strain JH9)
Q2FXS8 1.09e-21 84 46 1 98 1 rplU Large ribosomal subunit protein bL21 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FG80 1.09e-21 84 46 1 98 3 rplU Large ribosomal subunit protein bL21 Staphylococcus aureus (strain USA300)
A6U2B5 1.09e-21 84 46 1 98 3 rplU Large ribosomal subunit protein bL21 Staphylococcus aureus (strain JH1)
A7X364 1.09e-21 84 46 1 98 3 rplU Large ribosomal subunit protein bL21 Staphylococcus aureus (strain Mu3 / ATCC 700698)
A6WXR6 1.16e-21 85 43 1 101 3 rplU Large ribosomal subunit protein bL21 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A9M887 1.19e-21 85 43 1 101 3 rplU Large ribosomal subunit protein bL21 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
C1KVI9 1.26e-21 84 41 1 101 3 rplU Large ribosomal subunit protein bL21 Listeria monocytogenes serotype 4b (strain CLIP80459)
Q6NFV5 1.54e-21 84 41 1 101 3 rplU Large ribosomal subunit protein bL21 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
A9IM54 1.74e-21 85 41 0 101 3 rplU Large ribosomal subunit protein bL21 Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q5LRY0 2.23e-21 86 45 2 102 3 rplU Large ribosomal subunit protein bL21 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q9ZMD9 2.37e-21 84 45 0 100 3 rplU Large ribosomal subunit protein bL21 Helicobacter pylori (strain J99 / ATCC 700824)
A0AIZ1 2.92e-21 83 41 1 101 3 rplU Large ribosomal subunit protein bL21 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q92BH2 2.92e-21 83 41 1 101 3 rplU Large ribosomal subunit protein bL21 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q6G508 2.92e-21 85 41 0 101 3 rplU Large ribosomal subunit protein bL21 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
B3QZT4 3.15e-21 83 38 1 101 3 rplU Large ribosomal subunit protein bL21 Phytoplasma mali (strain AT)
Q9L1I0 4e-21 83 40 2 102 3 rplU Large ribosomal subunit protein bL21 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q4L6Z3 4.42e-21 83 45 1 98 3 rplU Large ribosomal subunit protein bL21 Staphylococcus haemolyticus (strain JCSC1435)
Q253F6 4.51e-21 83 38 1 101 3 rplU Large ribosomal subunit protein bL21 Chlamydia felis (strain Fe/C-56)
B9KER1 5.32e-21 82 41 1 101 3 rplU Large ribosomal subunit protein bL21 Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Q6A9I3 5.38e-21 82 40 1 101 1 rplU Large ribosomal subunit protein bL21 Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q98EY9 5.39e-21 86 41 0 101 3 rplU Large ribosomal subunit protein bL21 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B9DNF0 5.93e-21 82 46 1 98 3 rplU Large ribosomal subunit protein bL21 Staphylococcus carnosus (strain TM300)
Q88WN5 6.34e-21 82 41 1 101 3 rplU Large ribosomal subunit protein bL21 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A8HRT9 7.79e-21 82 48 1 102 3 rplU Large ribosomal subunit protein bL21 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q49Y85 8.23e-21 82 45 1 98 3 rplU Large ribosomal subunit protein bL21 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A7I2Z8 8.32e-21 82 42 1 101 3 rplU Large ribosomal subunit protein bL21 Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q8EVW7 9.29e-21 82 40 1 101 3 rplU Large ribosomal subunit protein bL21 Malacoplasma penetrans (strain HF-2)
A1URM6 1e-20 84 40 0 101 3 rplU Large ribosomal subunit protein bL21 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q17YA0 1.37e-20 82 44 0 100 3 rplU Large ribosomal subunit protein bL21 Helicobacter acinonychis (strain Sheeba)
Q8D277 1.41e-20 82 39 0 102 3 rplU Large ribosomal subunit protein bL21 Wigglesworthia glossinidia brevipalpis
A7NKR9 1.74e-20 82 40 1 101 3 rplU Large ribosomal subunit protein bL21 Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q8CS87 2.15e-20 81 44 1 98 3 rplU Large ribosomal subunit protein bL21 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HNQ4 2.15e-20 81 44 1 98 3 rplU Large ribosomal subunit protein bL21 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8DYV3 2.27e-20 81 42 1 100 3 rplU Large ribosomal subunit protein bL21 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E4G1 2.27e-20 81 42 1 100 3 rplU Large ribosomal subunit protein bL21 Streptococcus agalactiae serotype III (strain NEM316)
Q3K0E2 2.27e-20 81 42 1 100 3 rplU Large ribosomal subunit protein bL21 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q6MEQ8 2.57e-20 81 40 0 102 3 rplU Large ribosomal subunit protein bL21 Protochlamydia amoebophila (strain UWE25)
A8L1V8 3.8e-20 80 45 1 101 3 rplU Large ribosomal subunit protein bL21 Parafrankia sp. (strain EAN1pec)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_11745
Feature type CDS
Gene rplU
Product 50S ribosomal protein L21
Location 61855 - 62163 (strand: -1)
Length 309 (nucleotides) / 102 (amino acids)
In genomic island -

Contig

Accession ZDB_689
Length 162442 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1447
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00829 Ribosomal prokaryotic L21 protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0261 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L21

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02888 large subunit ribosomal protein L21 Ribosome -

Protein Sequence

MYAVFQSGGKQHRVSEGQIVRLEKLDIATGETVEFDQVLMVANGEDIKIGAPVVEGVKIKAEVVTHGRGDKIKIVKFRRRKHSRKQQGHRQWFTDVKITGIA

Flanking regions ( +/- flanking 50bp)

GTGCACTCTGAGAATCAAATTTTATGGGGTGTGCGGAAAGCGGAGTTAATATGTACGCGGTTTTCCAAAGTGGTGGTAAACAACACCGGGTCAGCGAAGGTCAAATCGTTCGCTTGGAAAAGCTGGACATCGCAACAGGTGAAACTGTTGAGTTTGACCAGGTTCTGATGGTTGCAAATGGTGAAGACATCAAGATCGGCGCTCCAGTCGTTGAAGGTGTTAAAATTAAAGCTGAAGTGGTTACACACGGTCGCGGCGATAAAATTAAAATCGTTAAGTTCCGTCGTCGTAAACACAGCCGGAAACAGCAGGGCCACCGTCAGTGGTTCACTGATGTTAAAATTACCGGTATCGCTTAAGTTAATAGGAGAGCAGATCAATGGCACACAAAAAGGCTGGCGGCTCGACT