Homologs in group_2031

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15005 FBDBKF_15005 100.0 Morganella morganii S1 yggL DUF469 domain-containing protein
EHELCC_11240 EHELCC_11240 100.0 Morganella morganii S2 yggL DUF469 domain-containing protein
NLDBIP_11585 NLDBIP_11585 100.0 Morganella morganii S4 yggL DUF469 domain-containing protein
LHKJJB_11445 LHKJJB_11445 100.0 Morganella morganii S3 yggL DUF469 domain-containing protein
F4V73_RS12445 F4V73_RS12445 83.3 Morganella psychrotolerans - YggL family protein
PMI_RS01565 PMI_RS01565 69.4 Proteus mirabilis HI4320 - YggL family protein

Distribution of the homologs in the orthogroup group_2031

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2031

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P38521 5.54e-47 149 60 0 108 4 yggL Uncharacterized protein YggL Escherichia coli (strain K12)
P44649 1.81e-41 135 52 0 108 1 HI_0341 Uncharacterized protein HI_0341 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_10055
Feature type CDS
Gene yggL
Product DUF469 domain-containing protein
Location 71830 - 72156 (strand: -1)
Length 327 (nucleotides) / 108 (amino acids)
In genomic island -

Contig

Accession ZDB_687
Length 188522 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2031
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04320 YggL 50S ribosome-binding protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3171 Function unknown (S) S Uncharacterized conserved protein YggL, DUF469 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09923 uncharacterized protein - -

Protein Sequence

MATQRSRRLRKKMRIDEFRELGFSFKWDFPEGTDVDTIDRTVDQLVEEVIEPNGLALDASGYLSWEAMVCLQKIGECTDEHRKLVGDWLKAKGMQNIQMSELFDIWWD

Flanking regions ( +/- flanking 50bp)

CATCGCTTAGGCCATGGCGTCTGGGATCTGATGTTTGAGAGGATGAAATAATGGCAACACAACGTAGTCGTCGTTTACGGAAAAAAATGCGTATCGATGAGTTCCGCGAACTCGGTTTTTCCTTCAAATGGGACTTCCCGGAAGGCACTGATGTCGACACTATCGACCGCACCGTTGACCAGCTGGTTGAGGAAGTGATCGAGCCGAACGGCCTGGCGCTGGATGCCAGCGGTTACCTGAGCTGGGAAGCCATGGTCTGTTTACAGAAAATCGGTGAATGTACCGATGAGCACCGTAAGCTGGTGGGTGACTGGCTGAAAGCCAAAGGGATGCAGAACATTCAGATGTCTGAACTGTTCGATATCTGGTGGGACTGAGATAAATTTCTTACCACGCTAATTATTAATAAGGGCACCTGAAAAGGTGC