Homologs in group_2031

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15005 FBDBKF_15005 83.3 Morganella morganii S1 yggL DUF469 domain-containing protein
EHELCC_11240 EHELCC_11240 83.3 Morganella morganii S2 yggL DUF469 domain-containing protein
NLDBIP_11585 NLDBIP_11585 83.3 Morganella morganii S4 yggL DUF469 domain-containing protein
LHKJJB_11445 LHKJJB_11445 83.3 Morganella morganii S3 yggL DUF469 domain-containing protein
HKOGLL_10055 HKOGLL_10055 83.3 Morganella morganii S5 yggL DUF469 domain-containing protein
PMI_RS01565 PMI_RS01565 70.4 Proteus mirabilis HI4320 - YggL family protein

Distribution of the homologs in the orthogroup group_2031

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2031

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P38521 1.06e-45 145 60 0 108 4 yggL Uncharacterized protein YggL Escherichia coli (strain K12)
P44649 1.58e-42 138 56 0 108 1 HI_0341 Uncharacterized protein HI_0341 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS12445
Feature type CDS
Gene -
Product YggL family protein
Location 72667 - 72993 (strand: -1)
Length 327 (nucleotides) / 108 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000003
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2031
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04320 YggL 50S ribosome-binding protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3171 Function unknown (S) S Uncharacterized conserved protein YggL, DUF469 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09923 uncharacterized protein - -

Protein Sequence

MAIQRSRRLRKKMHIGEFRELGFSFKWDFPEGTDINVVDSTVDALIAEVIEPNGLALDASGYMSWEGLACLEKIGECTDEHRKMVGDWLKNKGMQNIQMSELFDIWWD

Flanking regions ( +/- flanking 50bp)

CATCGCTTAGGGCATGGTGTCTGGGATCTGATGTTTGAGAGGATGAAATAATGGCAATACAACGCAGTCGTCGTTTACGGAAAAAAATGCACATCGGTGAGTTCCGCGAACTGGGTTTCTCTTTTAAGTGGGATTTCCCGGAAGGAACAGATATTAATGTTGTCGACAGTACTGTTGATGCACTGATCGCTGAAGTGATTGAGCCGAATGGCCTGGCACTGGACGCGAGCGGCTATATGAGCTGGGAAGGTCTTGCCTGTCTGGAAAAAATCGGCGAATGTACCGATGAACACCGCAAGATGGTGGGTGACTGGCTGAAAAACAAAGGTATGCAGAACATTCAGATGTCTGAATTGTTCGATATCTGGTGGGATTGAGATTAATTATTTACCACGCTAATCATTATAAGGGCACCTAATTTGGTGCC