Homologs in group_1146

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06560 FBDBKF_06560 100.0 Morganella morganii S1 yjjX inosine/xanthosine triphosphatase
EHELCC_09605 EHELCC_09605 100.0 Morganella morganii S2 yjjX inosine/xanthosine triphosphatase
NLDBIP_09985 NLDBIP_09985 100.0 Morganella morganii S4 yjjX inosine/xanthosine triphosphatase
LHKJJB_07770 LHKJJB_07770 100.0 Morganella morganii S3 yjjX inosine/xanthosine triphosphatase
F4V73_RS15375 F4V73_RS15375 97.2 Morganella psychrotolerans yjjX inosine/xanthosine triphosphatase
PMI_RS18485 PMI_RS18485 79.2 Proteus mirabilis HI4320 yjjX inosine/xanthosine triphosphatase

Distribution of the homologs in the orthogroup group_1146

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1146

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EY51 3.71e-104 299 79 0 178 3 PMI3715 Inosine/xanthosine triphosphatase Proteus mirabilis (strain HI4320)
Q7N901 7.29e-101 290 78 0 176 3 plu0558 Inosine/xanthosine triphosphatase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JJB7 1.14e-90 265 73 0 171 3 YE0591 Inosine/xanthosine triphosphatase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JL21 3.33e-88 259 73 0 171 3 YPK_3611 Inosine/xanthosine triphosphatase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66EU4 3.33e-88 259 73 0 171 3 YPTB0597 Inosine/xanthosine triphosphatase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K3K4 3.33e-88 259 73 0 171 3 YPTS_0619 Inosine/xanthosine triphosphatase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A4TQH6 4.43e-88 258 72 0 171 3 YPDSF_3180 Inosine/xanthosine triphosphatase Yersinia pestis (strain Pestoides F)
Q1CMX3 4.43e-88 258 72 0 171 3 YPN_0325 Inosine/xanthosine triphosphatase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R033 4.43e-88 258 72 0 171 3 YpAngola_A0816 Inosine/xanthosine triphosphatase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZIP1 4.43e-88 258 72 0 171 3 YPO0454 Inosine/xanthosine triphosphatase Yersinia pestis
Q1C0L6 4.43e-88 258 72 0 171 3 YPA_4045 Inosine/xanthosine triphosphatase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FMF9 1.16e-87 257 72 0 171 3 YpsIP31758_3483 Inosine/xanthosine triphosphatase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
C6DF26 3.34e-84 248 71 0 171 3 PC1_3675 Inosine/xanthosine triphosphatase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D0A1 3.76e-83 246 70 0 171 3 ECA3898 Inosine/xanthosine triphosphatase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A8G9J3 2.38e-80 239 67 0 174 3 Spro_0677 Inosine/xanthosine triphosphatase Serratia proteamaculans (strain 568)
B2VH10 5.96e-79 235 64 0 171 3 ETA_06920 Inosine/xanthosine triphosphatase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A7MIJ1 1.36e-67 206 56 0 171 3 ESA_03344 Inosine/xanthosine triphosphatase Cronobacter sakazakii (strain ATCC BAA-894)
A8ALW2 9.44e-67 204 56 0 171 3 CKO_03392 Inosine/xanthosine triphosphatase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q8FA41 2.88e-66 203 56 0 174 3 yjjX Inosine/xanthosine triphosphatase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7MNK3 2.88e-66 203 56 0 174 3 yjjX Inosine/xanthosine triphosphatase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UR24 2.88e-66 203 56 0 174 3 yjjX Inosine/xanthosine triphosphatase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A6TI08 6.76e-66 202 56 0 171 3 KPN78578_47680 Inosine/xanthosine triphosphatase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B1IS25 1.03e-65 201 56 0 173 3 yjjX Inosine/xanthosine triphosphatase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B5Y265 2.57e-65 200 56 0 171 3 KPK_4766 Inosine/xanthosine triphosphatase Klebsiella pneumoniae (strain 342)
A9MR95 7.49e-65 199 56 0 171 3 yjjX Inosine/xanthosine triphosphatase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B6I6P2 1.28e-64 199 56 0 170 3 yjjX Inosine/xanthosine triphosphatase Escherichia coli (strain SE11)
P39411 1.28e-64 199 56 0 170 1 yjjX Inosine/xanthosine triphosphatase Escherichia coli (strain K12)
B1XFK4 1.28e-64 199 56 0 170 3 yjjX Inosine/xanthosine triphosphatase Escherichia coli (strain K12 / DH10B)
C4ZT76 1.28e-64 199 56 0 170 3 yjjX Inosine/xanthosine triphosphatase Escherichia coli (strain K12 / MC4100 / BW2952)
B7LEP0 1.28e-64 199 56 0 170 3 yjjX Inosine/xanthosine triphosphatase Escherichia coli (strain 55989 / EAEC)
Q8XB14 3.32e-64 197 55 0 170 3 yjjX Inosine/xanthosine triphosphatase Escherichia coli O157:H7
A4W6B2 5.48e-64 197 56 0 171 3 Ent638_0555 Inosine/xanthosine triphosphatase Enterobacter sp. (strain 638)
P39432 5.39e-63 194 54 0 171 1 yjjX Inosine/xanthosine triphosphatase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5R9W2 5.51e-63 194 54 0 171 3 yjjX Inosine/xanthosine triphosphatase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R3B6 5.51e-63 194 54 0 171 3 yjjX Inosine/xanthosine triphosphatase Salmonella enteritidis PT4 (strain P125109)
B5FTD8 5.51e-63 194 54 0 171 3 yjjX Inosine/xanthosine triphosphatase Salmonella dublin (strain CT_02021853)
B5F542 5.51e-63 194 54 0 171 3 yjjX Inosine/xanthosine triphosphatase Salmonella agona (strain SL483)
B4TU54 9.61e-63 194 54 0 171 3 yjjX Inosine/xanthosine triphosphatase Salmonella schwarzengrund (strain CVM19633)
B5BAL0 9.94e-63 194 54 0 171 3 yjjX Inosine/xanthosine triphosphatase Salmonella paratyphi A (strain AKU_12601)
Q5PK30 9.94e-63 194 54 0 171 3 yjjX Inosine/xanthosine triphosphatase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T4I8 1.1e-62 194 54 0 171 3 yjjX Inosine/xanthosine triphosphatase Salmonella newport (strain SL254)
B4TH17 1.1e-62 194 54 0 171 3 yjjX Inosine/xanthosine triphosphatase Salmonella heidelberg (strain SL476)
A9N7F4 2.57e-62 193 54 0 171 3 yjjX Inosine/xanthosine triphosphatase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q57G27 2.57e-62 193 54 0 171 3 yjjX Inosine/xanthosine triphosphatase Salmonella choleraesuis (strain SC-B67)
C0Q8F4 4.39e-62 192 54 0 171 3 yjjX Inosine/xanthosine triphosphatase Salmonella paratyphi C (strain RKS4594)
Q5E7E1 7.72e-56 176 50 0 166 3 VF_0560 Inosine/xanthosine triphosphatase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5FAQ4 9.92e-56 176 50 0 166 3 VFMJ11_0572 Inosine/xanthosine triphosphatase Aliivibrio fischeri (strain MJ11)
Q8DEU6 3.42e-55 175 53 0 162 3 VV1_0488 Inosine/xanthosine triphosphatase Vibrio vulnificus (strain CMCP6)
Q7MNK7 1.23e-54 174 52 0 162 3 VV0708 Inosine/xanthosine triphosphatase Vibrio vulnificus (strain YJ016)
C3LSV6 1.28e-54 174 51 1 173 3 VCM66_0660 Inosine/xanthosine triphosphatase Vibrio cholerae serotype O1 (strain M66-2)
Q9KU27 1.28e-54 174 51 1 173 1 VC_0702 Inosine/xanthosine triphosphatase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q87S70 1.54e-54 173 53 0 162 3 VP0554 Inosine/xanthosine triphosphatase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q6LUG1 1.14e-53 171 51 0 168 3 PBPRA0643 Inosine/xanthosine triphosphatase Photobacterium profundum (strain SS9)
Q8EIC6 2.98e-32 117 39 5 174 3 SO_0917 Inosine/xanthosine triphosphatase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A0L0M2 9.89e-29 107 38 3 172 3 Shewana3_3367 Inosine/xanthosine triphosphatase Shewanella sp. (strain ANA-3)
Q0HRK8 1.44e-28 107 38 3 172 3 Shewmr7_3264 Inosine/xanthosine triphosphatase Shewanella sp. (strain MR-7)
Q0HM78 3.24e-28 106 38 3 172 3 Shewmr4_0759 Inosine/xanthosine triphosphatase Shewanella sp. (strain MR-4)
A6WS92 8.29e-25 97 36 2 165 3 Shew185_3554 Inosine/xanthosine triphosphatase Shewanella baltica (strain OS185)
A9L1P1 1.65e-24 97 36 2 165 3 Sbal195_3676 Inosine/xanthosine triphosphatase Shewanella baltica (strain OS195)
B1L5W9 1.66e-24 96 39 6 165 3 Kcr_1102 Probable inosine/xanthosine triphosphatase Korarchaeum cryptofilum (strain OPF8)
Q0W5C7 1.88e-24 96 33 7 180 3 UNCMA_17840 Probable inosine/xanthosine triphosphatase Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50)
O27919 1.87e-23 94 35 5 168 3 MTH_1897 Probable inosine/xanthosine triphosphatase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q5JJ32 1.03e-19 84 35 6 173 3 TK1747 Probable inosine/xanthosine triphosphatase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q8TV89 7.5e-19 82 31 3 170 3 MK1503 Probable inosine/xanthosine triphosphatase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
C3N7X4 4.59e-18 80 32 6 176 3 YG5714_0048 Probable inosine/xanthosine triphosphatase Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1)
C3NJ80 4.59e-18 80 32 6 176 3 YN1551_0048 Probable inosine/xanthosine triphosphatase Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2)
C3MJC4 4.59e-18 80 32 6 176 3 LS215_0048 Probable inosine/xanthosine triphosphatase Sulfolobus islandicus (strain L.S.2.15 / Lassen #1)
Q97WI6 5.5e-18 80 32 6 176 3 SSO2230 Probable inosine/xanthosine triphosphatase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
C4KJG4 6.8e-18 79 32 6 176 3 M164_0048 Probable inosine/xanthosine triphosphatase Sulfolobus islandicus (strain M.16.4 / Kamchatka #3)
C3N0B6 6.8e-18 79 32 6 176 3 M1627_0048 Probable inosine/xanthosine triphosphatase Sulfolobus islandicus (strain M.16.27)
C3MTQ6 2.05e-17 78 32 6 176 3 M1425_0048 Probable inosine/xanthosine triphosphatase Sulfolobus islandicus (strain M.14.25 / Kamchatka #1)
O29361 1.09e-16 76 29 5 171 3 AF_0901 Probable inosine/xanthosine triphosphatase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P39431 1.3e-16 73 53 0 66 3 None Inosine/xanthosine triphosphatase (Fragment) Enterobacter cloacae
Q96YP8 6.4e-16 74 31 5 166 3 STK_21250 Probable inosine/xanthosine triphosphatase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q57709 1.23e-15 73 32 6 165 3 MJ0261 Probable inosine/xanthosine triphosphatase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A3MVS2 5.48e-14 69 32 4 169 3 Pcal_1315 Probable inosine/xanthosine triphosphatase Pyrobaculum calidifontis (strain DSM 21063 / JCM 11548 / VA1)
P39430 6.65e-12 60 53 0 52 3 None Inosine/xanthosine triphosphatase (Fragment) Klebsiella aerogenes
Q8EP79 5.79e-11 61 28 6 165 3 OB2237 Probable inosine/xanthosine triphosphatase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q9K7V3 1.22e-10 60 28 5 167 3 BH3256 Probable inosine/xanthosine triphosphatase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A4WJ90 1.34e-10 60 30 4 168 3 Pars_0872 Probable inosine/xanthosine triphosphatase Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321 / PZ6)
A8MA42 7.78e-10 58 27 3 166 3 Cmaq_0122 Probable inosine/xanthosine triphosphatase Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167)
A1RUC0 1.22e-09 57 30 3 164 3 Pisl_1392 Probable inosine/xanthosine triphosphatase Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3)
Q9YDY1 8.38e-09 55 33 10 183 3 APE_0788.1 Probable inosine/xanthosine triphosphatase Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Q8ZUF6 4.45e-06 48 28 5 170 3 PAE2808 Probable inosine/xanthosine triphosphatase Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
B1YBH2 0.000429 42 29 4 167 3 Tneu_1859 Probable inosine/xanthosine triphosphatase Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / NBRC 100436 / V24Sta)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_07320
Feature type CDS
Gene yjjX
Product inosine/xanthosine triphosphatase
Location 63888 - 64424 (strand: -1)
Length 537 (nucleotides) / 178 (amino acids)

Contig

Accession ZDB_684
Length 217237 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1146
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01931 Protein of unknown function DUF84

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1986 Nucleotide transport and metabolism (F)
Defense mechanisms (V)		 FV Non-canonical (house-cleaning) NTP pyrophosphatase, all-alpha NTP-PPase family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01529 inosine/xanthosine triphosphatase [EC:3.6.1.73] Purine metabolism
Metabolic pathways
Nucleotide metabolism		 -

Protein Sequence

MFHIIAATTNPAKIQAIRSAFEVVLGNGNFDIEDVNVDSSVPQQPIGNTETRTGARQRVNAARQVRPEADFWVGVEAGIEGDMTFAWIVIEHRQLRGESRSASLMLPEKILAGIREGRELGDEMADLTGVEDIKQKGGAIGFFTGGALTRTSVYEQAIILALVPIQHEIYKSLNTKES

Flanking regions ( +/- flanking 50bp)

AATATTCGCTATACTGCGGCAAACATAATTACGTGGATAGTTTAATTATCATGTTTCATATTATCGCAGCAACGACTAATCCGGCCAAAATTCAGGCTATCCGTTCCGCTTTTGAAGTGGTACTGGGTAACGGCAATTTTGATATTGAAGATGTGAATGTGGACAGCAGTGTGCCGCAGCAGCCTATCGGGAACACAGAAACCCGTACCGGTGCCCGCCAGCGCGTCAATGCGGCCCGTCAGGTCAGACCGGAAGCGGATTTCTGGGTTGGTGTTGAGGCGGGTATTGAAGGCGATATGACCTTTGCCTGGATTGTTATCGAGCACCGTCAGCTGCGCGGGGAATCCCGTTCTGCCAGCCTGATGCTGCCGGAAAAAATTCTCGCGGGGATCCGCGAAGGCCGCGAACTGGGTGATGAAATGGCCGACCTGACCGGGGTGGAAGATATCAAACAGAAAGGCGGAGCGATCGGTTTCTTCACCGGCGGCGCGCTGACCCGCACCAGTGTCTATGAGCAGGCAATTATCCTGGCGCTGGTGCCTATCCAGCATGAAATTTATAAATCCCTGAACACCAAAGAATCCTGATCTGAAAAACCGGACCGGTACTCACCGGCCCGGTGACCTTCCCGGCACAT