Homologs in group_1146

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06560 FBDBKF_06560 97.2 Morganella morganii S1 yjjX inosine/xanthosine triphosphatase
EHELCC_09605 EHELCC_09605 97.2 Morganella morganii S2 yjjX inosine/xanthosine triphosphatase
NLDBIP_09985 NLDBIP_09985 97.2 Morganella morganii S4 yjjX inosine/xanthosine triphosphatase
LHKJJB_07770 LHKJJB_07770 97.2 Morganella morganii S3 yjjX inosine/xanthosine triphosphatase
HKOGLL_07320 HKOGLL_07320 97.2 Morganella morganii S5 yjjX inosine/xanthosine triphosphatase
PMI_RS18485 PMI_RS18485 77.7 Proteus mirabilis HI4320 yjjX inosine/xanthosine triphosphatase

Distribution of the homologs in the orthogroup group_1146

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1146

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EY51 2.41e-103 297 78 0 178 3 PMI3715 Inosine/xanthosine triphosphatase Proteus mirabilis (strain HI4320)
Q7N901 1.39e-100 290 78 0 176 3 plu0558 Inosine/xanthosine triphosphatase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JJB7 1.09e-89 262 73 0 171 3 YE0591 Inosine/xanthosine triphosphatase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JL21 2.31e-87 256 72 0 171 3 YPK_3611 Inosine/xanthosine triphosphatase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66EU4 2.31e-87 256 72 0 171 3 YPTB0597 Inosine/xanthosine triphosphatase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K3K4 2.31e-87 256 72 0 171 3 YPTS_0619 Inosine/xanthosine triphosphatase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A4TQH6 3.24e-87 256 71 0 171 3 YPDSF_3180 Inosine/xanthosine triphosphatase Yersinia pestis (strain Pestoides F)
Q1CMX3 3.24e-87 256 71 0 171 3 YPN_0325 Inosine/xanthosine triphosphatase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R033 3.24e-87 256 71 0 171 3 YpAngola_A0816 Inosine/xanthosine triphosphatase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZIP1 3.24e-87 256 71 0 171 3 YPO0454 Inosine/xanthosine triphosphatase Yersinia pestis
Q1C0L6 3.24e-87 256 71 0 171 3 YPA_4045 Inosine/xanthosine triphosphatase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FMF9 6.6e-87 255 71 0 171 3 YpsIP31758_3483 Inosine/xanthosine triphosphatase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
C6DF26 1.88e-83 247 70 0 171 3 PC1_3675 Inosine/xanthosine triphosphatase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D0A1 1.39e-82 244 70 0 171 3 ECA3898 Inosine/xanthosine triphosphatase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A8G9J3 9.41e-80 237 64 0 179 3 Spro_0677 Inosine/xanthosine triphosphatase Serratia proteamaculans (strain 568)
B2VH10 1.7e-78 234 64 0 171 3 ETA_06920 Inosine/xanthosine triphosphatase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A7MIJ1 7.26e-68 207 57 0 171 3 ESA_03344 Inosine/xanthosine triphosphatase Cronobacter sakazakii (strain ATCC BAA-894)
A8ALW2 4.71e-67 205 56 0 171 3 CKO_03392 Inosine/xanthosine triphosphatase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q8FA41 1.67e-66 204 57 0 173 3 yjjX Inosine/xanthosine triphosphatase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7MNK3 1.67e-66 204 57 0 173 3 yjjX Inosine/xanthosine triphosphatase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UR24 1.67e-66 204 57 0 173 3 yjjX Inosine/xanthosine triphosphatase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A6TI08 4.79e-66 202 57 0 171 3 KPN78578_47680 Inosine/xanthosine triphosphatase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B1IS25 5.11e-66 202 56 0 173 3 yjjX Inosine/xanthosine triphosphatase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B5Y265 1.28e-65 201 57 0 171 3 KPK_4766 Inosine/xanthosine triphosphatase Klebsiella pneumoniae (strain 342)
A9MR95 3.35e-65 200 57 0 171 3 yjjX Inosine/xanthosine triphosphatase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B6I6P2 5.25e-65 199 57 0 170 3 yjjX Inosine/xanthosine triphosphatase Escherichia coli (strain SE11)
P39411 5.25e-65 199 57 0 170 1 yjjX Inosine/xanthosine triphosphatase Escherichia coli (strain K12)
B1XFK4 5.25e-65 199 57 0 170 3 yjjX Inosine/xanthosine triphosphatase Escherichia coli (strain K12 / DH10B)
C4ZT76 5.25e-65 199 57 0 170 3 yjjX Inosine/xanthosine triphosphatase Escherichia coli (strain K12 / MC4100 / BW2952)
B7LEP0 5.25e-65 199 57 0 170 3 yjjX Inosine/xanthosine triphosphatase Escherichia coli (strain 55989 / EAEC)
Q8XB14 1.25e-64 199 56 0 170 3 yjjX Inosine/xanthosine triphosphatase Escherichia coli O157:H7
A4W6B2 1.79e-63 196 56 0 171 3 Ent638_0555 Inosine/xanthosine triphosphatase Enterobacter sp. (strain 638)
P39432 2.81e-63 195 55 0 171 1 yjjX Inosine/xanthosine triphosphatase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5R9W2 3e-63 195 55 0 171 3 yjjX Inosine/xanthosine triphosphatase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R3B6 3e-63 195 55 0 171 3 yjjX Inosine/xanthosine triphosphatase Salmonella enteritidis PT4 (strain P125109)
B5FTD8 3e-63 195 55 0 171 3 yjjX Inosine/xanthosine triphosphatase Salmonella dublin (strain CT_02021853)
B5F542 3e-63 195 55 0 171 3 yjjX Inosine/xanthosine triphosphatase Salmonella agona (strain SL483)
B5BAL0 6.17e-63 194 55 0 171 3 yjjX Inosine/xanthosine triphosphatase Salmonella paratyphi A (strain AKU_12601)
Q5PK30 6.17e-63 194 55 0 171 3 yjjX Inosine/xanthosine triphosphatase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T4I8 6.24e-63 194 55 0 171 3 yjjX Inosine/xanthosine triphosphatase Salmonella newport (strain SL254)
B4TH17 6.24e-63 194 55 0 171 3 yjjX Inosine/xanthosine triphosphatase Salmonella heidelberg (strain SL476)
B4TU54 6.66e-63 194 54 0 171 3 yjjX Inosine/xanthosine triphosphatase Salmonella schwarzengrund (strain CVM19633)
A9N7F4 1.71e-62 193 54 0 171 3 yjjX Inosine/xanthosine triphosphatase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q57G27 1.71e-62 193 54 0 171 3 yjjX Inosine/xanthosine triphosphatase Salmonella choleraesuis (strain SC-B67)
C0Q8F4 8.23e-62 191 54 0 171 3 yjjX Inosine/xanthosine triphosphatase Salmonella paratyphi C (strain RKS4594)
Q8DEU6 5.03e-55 175 53 0 162 3 VV1_0488 Inosine/xanthosine triphosphatase Vibrio vulnificus (strain CMCP6)
Q7MNK7 1.62e-54 174 52 0 162 3 VV0708 Inosine/xanthosine triphosphatase Vibrio vulnificus (strain YJ016)
Q5E7E1 2.29e-54 172 48 0 166 3 VF_0560 Inosine/xanthosine triphosphatase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5FAQ4 3.39e-54 172 49 0 166 3 VFMJ11_0572 Inosine/xanthosine triphosphatase Aliivibrio fischeri (strain MJ11)
C3LSV6 1.78e-53 171 50 1 173 3 VCM66_0660 Inosine/xanthosine triphosphatase Vibrio cholerae serotype O1 (strain M66-2)
Q9KU27 1.78e-53 171 50 1 173 1 VC_0702 Inosine/xanthosine triphosphatase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q6LUG1 1.83e-53 171 51 0 168 3 PBPRA0643 Inosine/xanthosine triphosphatase Photobacterium profundum (strain SS9)
Q87S70 3.29e-53 170 51 0 162 3 VP0554 Inosine/xanthosine triphosphatase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8EIC6 8.43e-33 118 41 5 174 3 SO_0917 Inosine/xanthosine triphosphatase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A0L0M2 3.67e-29 108 38 3 172 3 Shewana3_3367 Inosine/xanthosine triphosphatase Shewanella sp. (strain ANA-3)
Q0HRK8 5.29e-29 108 38 3 172 3 Shewmr7_3264 Inosine/xanthosine triphosphatase Shewanella sp. (strain MR-7)
Q0HM78 1.04e-28 107 38 3 172 3 Shewmr4_0759 Inosine/xanthosine triphosphatase Shewanella sp. (strain MR-4)
B1L5W9 5.36e-25 98 39 6 166 3 Kcr_1102 Probable inosine/xanthosine triphosphatase Korarchaeum cryptofilum (strain OPF8)
A6WS92 2.9e-24 96 36 2 165 3 Shew185_3554 Inosine/xanthosine triphosphatase Shewanella baltica (strain OS185)
A9L1P1 5.05e-24 95 36 2 165 3 Sbal195_3676 Inosine/xanthosine triphosphatase Shewanella baltica (strain OS195)
Q0W5C7 3.69e-23 93 32 6 180 3 UNCMA_17840 Probable inosine/xanthosine triphosphatase Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50)
O27919 6.8e-23 92 34 5 169 3 MTH_1897 Probable inosine/xanthosine triphosphatase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q5JJ32 5.73e-19 82 35 5 173 3 TK1747 Probable inosine/xanthosine triphosphatase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
C3N7X4 1.76e-17 78 32 6 176 3 YG5714_0048 Probable inosine/xanthosine triphosphatase Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1)
C3NJ80 1.76e-17 78 32 6 176 3 YN1551_0048 Probable inosine/xanthosine triphosphatase Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2)
C3MJC4 1.76e-17 78 32 6 176 3 LS215_0048 Probable inosine/xanthosine triphosphatase Sulfolobus islandicus (strain L.S.2.15 / Lassen #1)
Q97WI6 2.04e-17 78 32 6 176 3 SSO2230 Probable inosine/xanthosine triphosphatase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
C4KJG4 2.36e-17 78 32 6 176 3 M164_0048 Probable inosine/xanthosine triphosphatase Sulfolobus islandicus (strain M.16.4 / Kamchatka #3)
C3N0B6 2.36e-17 78 32 6 176 3 M1627_0048 Probable inosine/xanthosine triphosphatase Sulfolobus islandicus (strain M.16.27)
Q8TV89 2.61e-17 78 30 3 170 3 MK1503 Probable inosine/xanthosine triphosphatase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
C3MTQ6 8.22e-17 77 31 6 176 3 M1425_0048 Probable inosine/xanthosine triphosphatase Sulfolobus islandicus (strain M.14.25 / Kamchatka #1)
P39431 2.57e-16 72 53 0 66 3 None Inosine/xanthosine triphosphatase (Fragment) Enterobacter cloacae
O29361 3.07e-16 75 29 5 171 3 AF_0901 Probable inosine/xanthosine triphosphatase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q96YP8 1.51e-15 73 31 5 166 3 STK_21250 Probable inosine/xanthosine triphosphatase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q57709 1.71e-15 73 31 5 165 3 MJ0261 Probable inosine/xanthosine triphosphatase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A3MVS2 1.03e-13 68 32 4 169 3 Pcal_1315 Probable inosine/xanthosine triphosphatase Pyrobaculum calidifontis (strain DSM 21063 / JCM 11548 / VA1)
P39430 1.59e-11 59 53 0 52 3 None Inosine/xanthosine triphosphatase (Fragment) Klebsiella aerogenes
Q8EP79 4.04e-11 61 29 6 165 3 OB2237 Probable inosine/xanthosine triphosphatase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q9K7V3 3.53e-10 59 28 5 167 3 BH3256 Probable inosine/xanthosine triphosphatase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A1RUC0 8.72e-10 58 31 3 164 3 Pisl_1392 Probable inosine/xanthosine triphosphatase Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3)
A4WJ90 8.9e-10 58 30 4 168 3 Pars_0872 Probable inosine/xanthosine triphosphatase Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321 / PZ6)
A8MA42 1.66e-09 57 27 3 166 3 Cmaq_0122 Probable inosine/xanthosine triphosphatase Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167)
Q9YDY1 6.39e-08 53 32 9 184 3 APE_0788.1 Probable inosine/xanthosine triphosphatase Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Q8ZUF6 2.94e-05 45 28 5 170 3 PAE2808 Probable inosine/xanthosine triphosphatase Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS15375
Feature type CDS
Gene yjjX
Product inosine/xanthosine triphosphatase
Location 60618 - 61157 (strand: -1)
Length 540 (nucleotides) / 179 (amino acids)

Contig

Accession term accessions NZ_VXKB01000005 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 213534 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1146
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01931 Protein of unknown function DUF84

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1986 Nucleotide transport and metabolism (F)
Defense mechanisms (V)		 FV Non-canonical (house-cleaning) NTP pyrophosphatase, all-alpha NTP-PPase family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01529 inosine/xanthosine triphosphatase [EC:3.6.1.73] Purine metabolism
Metabolic pathways
Nucleotide metabolism		 -

Protein Sequence

MFHIIAATTNPAKIQAIRAAFEVVLGNGNFDIEDVNVDSSVPQQPIGNTETRTGARQRVNAARQVRPEADFWVGVEAGIDGDMTFAWIVIEHQQLRGESRSASLMLPEKILAGIREGRELGDEMADLTGVEDIKQKGGAIGFFTGGALTRTSVYEQATILALVPIQHEIYKSLNTKEER

Flanking regions ( +/- flanking 50bp)

AATATTCGCTATACTGCGCCAAACAAAATAACGTGGGTAGTTTAATTATCATGTTTCATATTATCGCAGCGACGACTAACCCGGCTAAAATTCAGGCAATTCGTGCCGCTTTTGAAGTGGTTTTAGGGAACGGAAATTTTGATATTGAAGATGTGAATGTGGACAGCAGTGTGCCACAGCAACCCATCGGGAATACCGAAACCCGTACCGGAGCCCGTCAGCGTGTAAATGCTGCCCGCCAGGTAAGACCGGAAGCAGATTTCTGGGTCGGCGTTGAAGCCGGTATTGACGGCGATATGACCTTTGCCTGGATTGTCATTGAACACCAGCAATTGCGGGGCGAATCCCGTTCAGCCAGCCTGATGCTGCCGGAGAAAATTCTGGCGGGGATCCGCGAAGGCCGTGAACTGGGCGATGAAATGGCGGATCTGACCGGCGTGGAAGATATTAAACAAAAAGGCGGCGCGATTGGTTTCTTCACCGGCGGCGCACTTACCCGCACCAGCGTGTATGAGCAGGCAACCATCCTGGCTCTCGTCCCTATCCAGCACGAAATCTACAAATCACTGAATACCAAAGAAGAAAGATAAAAAAACCGGACCGGCGACAACCGGCCCGGCGACTTTTTCACACCTTTGAC