Homologs in group_2707

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06650 FBDBKF_06650 100.0 Morganella morganii S1 ureE Urease accessory protein UreE
EHELCC_09695 EHELCC_09695 100.0 Morganella morganii S2 ureE Urease accessory protein UreE
NLDBIP_10075 NLDBIP_10075 100.0 Morganella morganii S4 ureE Urease accessory protein UreE
LHKJJB_07680 LHKJJB_07680 100.0 Morganella morganii S3 ureE Urease accessory protein UreE
F4V73_RS15285 F4V73_RS15285 89.8 Morganella psychrotolerans ureE urease accessory protein UreE

Distribution of the homologs in the orthogroup group_2707

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2707

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A4TL31 2.89e-93 275 66 2 206 3 ureE Urease accessory protein UreE Yersinia pestis (strain Pestoides F)
Q1CKJ8 2.89e-93 275 66 2 206 3 ureE Urease accessory protein UreE Yersinia pestis bv. Antiqua (strain Nepal516)
A9R3V1 2.89e-93 275 66 2 206 3 ureE Urease accessory protein UreE Yersinia pestis bv. Antiqua (strain Angola)
Q9ZFR8 2.89e-93 275 66 2 206 3 ureE Urease accessory protein UreE Yersinia pestis
Q1C5B2 2.89e-93 275 66 2 206 3 ureE Urease accessory protein UreE Yersinia pestis bv. Antiqua (strain Antiqua)
B1JR72 7.1e-93 275 66 2 205 3 ureE Urease accessory protein UreE Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
P52317 7.1e-93 275 66 2 205 3 ureE Urease accessory protein UreE Yersinia pseudotuberculosis serotype I (strain IP32953)
B2KAA3 7.1e-93 275 66 2 205 3 ureE Urease accessory protein UreE Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FFN3 7.1e-93 275 66 2 205 3 ureE Urease accessory protein UreE Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
P42869 1.46e-90 268 64 2 205 3 ureE Urease accessory protein UreE Yersinia enterocolitica
A1JKE0 1.46e-90 268 64 2 205 3 ureE Urease accessory protein UreE Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q6UR67 2.64e-90 268 65 1 201 3 ureE Urease accessory protein UreE Yersinia frederiksenii
Q6UR83 7.19e-90 267 64 2 205 3 ureE Urease accessory protein UreE Yersinia aldovae
Q6UR59 7.44e-89 264 65 0 196 3 ureE Urease accessory protein UreE Yersinia intermedia
Q6UR50 2.45e-88 263 64 0 196 3 ureE Urease accessory protein UreE Yersinia kristensenii
Q6UR41 3.46e-87 260 64 0 196 3 ureE Urease accessory protein UreE Yersinia mollaretii
Q6UR32 1.07e-85 256 62 2 228 3 ureE Urease accessory protein UreE Yersinia rohdei
Q6UR75 7.23e-85 254 63 2 216 3 ureE Urease accessory protein UreE Yersinia bercovieri
Q6J171 1.81e-66 207 52 3 223 3 ureE Urease accessory protein UreE Edwardsiella ictaluri
Q3IRZ1 1.9e-16 78 30 4 170 3 ureE Urease accessory protein UreE Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q883F1 3.65e-06 48 28 6 139 3 ureE1 Urease accessory protein UreE 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P50049 4.43e-06 48 29 5 128 1 ureE Urease accessory protein UreE Sporosarcina pasteurii
Q4A0J6 6.43e-06 48 26 4 146 3 ureE Urease accessory protein UreE Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
B9DLY1 2.62e-05 46 25 4 146 3 ureE Urease accessory protein UreE Staphylococcus carnosus (strain TM300)
Q4ZUC9 4.67e-05 45 28 6 139 3 ureE1 Urease accessory protein UreE 1 Pseudomonas syringae pv. syringae (strain B728a)
Q6GEE3 8.31e-05 44 24 4 146 3 ureE Urease accessory protein UreE Staphylococcus aureus (strain MRSA252)
Q7A065 0.000129 44 23 4 146 3 ureE Urease accessory protein UreE Staphylococcus aureus (strain MW2)
A8Z388 0.000129 44 23 4 146 3 ureE Urease accessory protein UreE Staphylococcus aureus (strain USA300 / TCH1516)
Q6G731 0.000129 44 23 4 146 3 ureE Urease accessory protein UreE Staphylococcus aureus (strain MSSA476)
Q7A429 0.000129 44 23 4 146 1 ureE Urease accessory protein UreE Staphylococcus aureus (strain N315)
Q99RY1 0.000129 44 23 4 146 3 ureE Urease accessory protein UreE Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJD1 0.000129 44 23 4 146 3 ureE Urease accessory protein UreE Staphylococcus aureus (strain Newman)
Q5HDR7 0.000129 44 23 4 146 3 ureE Urease accessory protein UreE Staphylococcus aureus (strain COL)
Q2YYQ5 0.000129 44 23 4 146 3 ureE Urease accessory protein UreE Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IV72 0.000129 44 23 4 146 3 ureE Urease accessory protein UreE Staphylococcus aureus (strain JH9)
Q2G2K8 0.000129 44 23 4 146 3 ureE Urease accessory protein UreE Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FEK2 0.000129 44 23 4 146 3 ureE Urease accessory protein UreE Staphylococcus aureus (strain USA300)
A6U415 0.000129 44 23 4 146 3 ureE Urease accessory protein UreE Staphylococcus aureus (strain JH1)
A7X5M4 0.000129 44 23 4 146 3 ureE Urease accessory protein UreE Staphylococcus aureus (strain Mu3 / ATCC 700698)
B7GT18 0.000263 44 27 12 232 3 ureE Urease accessory protein UreE Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q8IFN0 0.000282 45 44 0 38 1 PFD1115c Uncharacterized protein PFD1115c Plasmodium falciparum (isolate 3D7)
Q8IFN0 0.000282 45 44 0 38 1 PFD1115c Uncharacterized protein PFD1115c Plasmodium falciparum (isolate 3D7)
Q8CNC8 0.000487 42 25 3 128 3 ureE Urease accessory protein UreE Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HLW0 0.000487 42 25 3 128 3 ureE Urease accessory protein UreE Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q1H0F3 0.000545 42 31 2 85 3 ureE Urease accessory protein UreE Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A3DGF7 0.000768 42 22 5 146 3 ureE Urease accessory protein UreE Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_07230
Feature type CDS
Gene ureE
Product Urease accessory protein UreE
Location 45440 - 46117 (strand: 1)
Length 678 (nucleotides) / 225 (amino acids)

Contig

Accession ZDB_684
Length 217237 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2707
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF02814 UreE urease accessory protein, N-terminal domain
PF05194 UreE urease accessory protein, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2371 Posttranslational modification, protein turnover, chaperones (O) O Urease accessory protein UreE

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03187 urease accessory protein - -

Protein Sequence

MILIEHILGNVRKDQAWADKANEMTVDMLILDQREAQKSRCRKHTQNGLDIGIALDRNVLLSDGDVIHTDDATNTMVVVQIDLRDVMVVDLKRLQGSTPEEQIRISFELGHALGNQHWKAVIKENKVYVPLTVSEKVMESVMRTHGFGNDTFAFVKGETILPILTNSESRLLFGGAEETDTHVHVAHNHGHSHSHGHDHGHSHDHDHSHDHGHDHHHDHDHDHKH

Flanking regions ( +/- flanking 50bp)

TCCCCGGCGGGTGTTGTTCTGCCCGCCGGGCATAACAAAAAGGTAATTCCATGATCCTCATTGAGCACATTCTCGGCAACGTCAGAAAAGATCAGGCGTGGGCTGATAAAGCGAACGAAATGACGGTGGATATGCTGATCCTCGATCAGCGTGAAGCCCAGAAAAGCCGCTGCCGTAAACACACCCAAAACGGGCTGGATATCGGGATCGCGCTGGATCGCAACGTGCTGTTGTCTGACGGAGATGTGATCCACACCGACGACGCCACCAATACGATGGTTGTTGTCCAGATCGATCTGCGTGATGTCATGGTTGTTGATCTTAAACGTCTTCAGGGCAGCACGCCGGAAGAGCAGATCCGCATCAGTTTTGAACTGGGCCATGCGCTCGGTAACCAGCACTGGAAAGCCGTTATCAAAGAAAACAAGGTGTATGTCCCGCTGACCGTCAGTGAAAAAGTGATGGAATCGGTGATGCGCACCCACGGCTTCGGCAATGATACGTTTGCCTTCGTCAAAGGCGAAACCATTCTGCCGATCCTGACCAACTCAGAATCCCGTCTGCTGTTCGGCGGCGCGGAAGAGACAGATACTCACGTGCATGTGGCACATAACCACGGGCACTCACATTCACACGGCCACGATCACGGGCACAGCCATGATCATGACCACAGTCACGACCACGGCCATGATCATCACCACGATCACGACCATGACCACAAACACTGACAGACCGGAACGGGAGAACGTGTGATGAAAGCGGCTGATCTTATCCGGAT