Homologs in group_2734

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06650 FBDBKF_06650 89.8 Morganella morganii S1 ureE Urease accessory protein UreE
EHELCC_09695 EHELCC_09695 89.8 Morganella morganii S2 ureE Urease accessory protein UreE
NLDBIP_10075 NLDBIP_10075 89.8 Morganella morganii S4 ureE Urease accessory protein UreE
LHKJJB_07680 LHKJJB_07680 89.8 Morganella morganii S3 ureE Urease accessory protein UreE
HKOGLL_07230 HKOGLL_07230 89.8 Morganella morganii S5 ureE Urease accessory protein UreE

Distribution of the homologs in the orthogroup group_2734

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2734

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A4TL31 3e-92 273 67 1 202 3 ureE Urease accessory protein UreE Yersinia pestis (strain Pestoides F)
Q1CKJ8 3e-92 273 67 1 202 3 ureE Urease accessory protein UreE Yersinia pestis bv. Antiqua (strain Nepal516)
A9R3V1 3e-92 273 67 1 202 3 ureE Urease accessory protein UreE Yersinia pestis bv. Antiqua (strain Angola)
Q9ZFR8 3e-92 273 67 1 202 3 ureE Urease accessory protein UreE Yersinia pestis
Q1C5B2 3e-92 273 67 1 202 3 ureE Urease accessory protein UreE Yersinia pestis bv. Antiqua (strain Antiqua)
B1JR72 3.82e-92 273 67 1 202 3 ureE Urease accessory protein UreE Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
P52317 3.82e-92 273 67 1 202 3 ureE Urease accessory protein UreE Yersinia pseudotuberculosis serotype I (strain IP32953)
B2KAA3 3.82e-92 273 67 1 202 3 ureE Urease accessory protein UreE Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FFN3 3.82e-92 273 67 1 202 3 ureE Urease accessory protein UreE Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
P42869 2.2e-91 271 65 2 208 3 ureE Urease accessory protein UreE Yersinia enterocolitica
A1JKE0 2.2e-91 271 65 2 208 3 ureE Urease accessory protein UreE Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q6UR67 1.11e-89 267 65 1 202 3 ureE Urease accessory protein UreE Yersinia frederiksenii
Q6UR83 3.46e-89 265 65 2 206 3 ureE Urease accessory protein UreE Yersinia aldovae
Q6UR32 2.4e-88 263 65 1 202 3 ureE Urease accessory protein UreE Yersinia rohdei
Q6UR50 4.27e-88 262 65 0 194 3 ureE Urease accessory protein UreE Yersinia kristensenii
Q6UR59 1.19e-87 261 65 1 201 3 ureE Urease accessory protein UreE Yersinia intermedia
Q6UR41 1.41e-86 258 65 0 194 3 ureE Urease accessory protein UreE Yersinia mollaretii
Q6UR75 1.63e-82 248 58 2 224 3 ureE Urease accessory protein UreE Yersinia bercovieri
Q6J171 2.9e-66 207 49 3 221 3 ureE Urease accessory protein UreE Edwardsiella ictaluri
Q3IRZ1 1.15e-13 70 31 4 187 3 ureE Urease accessory protein UreE Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
P50049 2.43e-07 52 30 3 110 1 ureE Urease accessory protein UreE Sporosarcina pasteurii
B9DLY1 6.07e-06 48 28 3 128 3 ureE Urease accessory protein UreE Staphylococcus carnosus (strain TM300)
Q883F1 9.61e-06 47 28 6 139 3 ureE1 Urease accessory protein UreE 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4A0J6 1.32e-05 47 29 4 128 3 ureE Urease accessory protein UreE Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q4ZUC9 3.54e-05 45 27 5 139 3 ureE1 Urease accessory protein UreE 1 Pseudomonas syringae pv. syringae (strain B728a)
Q6GEE3 0.000103 44 27 3 128 3 ureE Urease accessory protein UreE Staphylococcus aureus (strain MRSA252)
P0CB04 0.000117 44 34 3 82 3 ureE Urease accessory protein UreE Ureaplasma urealyticum
B5ZBS8 0.000117 44 34 3 82 3 ureE Urease accessory protein UreE Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western)
Q7A065 0.000141 44 26 3 128 3 ureE Urease accessory protein UreE Staphylococcus aureus (strain MW2)
A8Z388 0.000141 44 26 3 128 3 ureE Urease accessory protein UreE Staphylococcus aureus (strain USA300 / TCH1516)
Q6G731 0.000141 44 26 3 128 3 ureE Urease accessory protein UreE Staphylococcus aureus (strain MSSA476)
Q7A429 0.000141 44 26 3 128 1 ureE Urease accessory protein UreE Staphylococcus aureus (strain N315)
Q99RY1 0.000141 44 26 3 128 3 ureE Urease accessory protein UreE Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJD1 0.000141 44 26 3 128 3 ureE Urease accessory protein UreE Staphylococcus aureus (strain Newman)
Q5HDR7 0.000141 44 26 3 128 3 ureE Urease accessory protein UreE Staphylococcus aureus (strain COL)
Q2YYQ5 0.000141 44 26 3 128 3 ureE Urease accessory protein UreE Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IV72 0.000141 44 26 3 128 3 ureE Urease accessory protein UreE Staphylococcus aureus (strain JH9)
Q2G2K8 0.000141 44 26 3 128 3 ureE Urease accessory protein UreE Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FEK2 0.000141 44 26 3 128 3 ureE Urease accessory protein UreE Staphylococcus aureus (strain USA300)
A6U415 0.000141 44 26 3 128 3 ureE Urease accessory protein UreE Staphylococcus aureus (strain JH1)
A7X5M4 0.000141 44 26 3 128 3 ureE Urease accessory protein UreE Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q56559 0.000176 43 33 3 83 3 ureE Urease accessory protein UreE Ureaplasma parvum serovar 3 (strain ATCC 700970)
B1AJ72 0.000176 43 33 3 83 3 ureE Urease accessory protein UreE Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736)
Q8CNC8 0.000179 43 25 3 128 3 ureE Urease accessory protein UreE Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HLW0 0.000179 43 25 3 128 3 ureE Urease accessory protein UreE Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A3DGF7 0.000188 43 23 5 146 3 ureE Urease accessory protein UreE Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
O06708 0.001 43 27 9 181 3 ureEF Bifunctional urease accessory protein UreEF Bordetella bronchiseptica

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS15285
Feature type CDS
Gene ureE
Product urease accessory protein UreE
Location 43083 - 43772 (strand: 1)
Length 690 (nucleotides) / 229 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000005
Length 213534 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2734
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF02814 UreE urease accessory protein, N-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2371 Posttranslational modification, protein turnover, chaperones (O) O Urease accessory protein UreE

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03187 urease accessory protein - -

Protein Sequence

MILIEHILGNVRKETAWAEKANDMTVDMLILDQREAQKSRCRKHTQNGLDLGIALDRNVLLSDGDVIYTDDATNTMVVVQIDLRDVMVIDLQRLQGSTPSEQIRISFELGHALGNQHWKAVIKENKVYVPLTVSEKVMESVMRTHNFGNDTFAFVKGETILPILTNSESRLLFGGAEETDTHVHVAHHPRHDHGHSHSHDHGDGNSHDHSHDHNNDHGHGHEHDHDHKH

Flanking regions ( +/- flanking 50bp)

ACCCCGGCGGGCAGATATCTGCCTGCCGGGCATAATAAAAAGGTAATTCCATGATCCTCATTGAGCACATTCTCGGTAACGTCAGAAAAGAGACGGCGTGGGCTGAAAAAGCAAATGATATGACGGTGGATATGCTGATCCTTGATCAGCGGGAAGCCCAGAAAAGTCGTTGTCGTAAACATACCCAAAACGGGCTGGATCTCGGGATCGCATTAGATCGCAATGTCCTGCTGTCTGACGGCGACGTTATCTATACCGATGATGCAACAAATACCATGGTGGTGGTTCAGATTGACCTGCGCGATGTGATGGTTATTGATCTTCAGCGTCTGCAGGGCAGTACGCCGTCAGAGCAAATCCGTATCAGTTTCGAACTGGGACATGCGCTCGGCAACCAGCACTGGAAAGCCGTGATTAAAGAAAACAAAGTCTATGTTCCGCTGACCGTCAGTGAAAAAGTGATGGAGTCGGTCATGCGCACTCATAACTTCGGCAATGACACATTTGCATTTGTAAAAGGCGAAACCATTCTGCCGATCCTGACAAATTCAGAATCCCGTCTGCTGTTCGGCGGCGCGGAAGAAACGGATACCCATGTGCATGTGGCACATCATCCGCGTCACGATCACGGACATTCGCACAGCCATGACCACGGTGACGGAAACAGTCACGATCATAGCCATGATCATAATAACGATCATGGTCACGGGCATGAGCACGATCATGACCATAAGCACTGATCAATCAGACGGAGGGTAAGTAAGATGAAAGCGTCTGATCTTATCCGGAT