Homologs in group_1786

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13025 FBDBKF_13025 100.0 Morganella morganii S1 ybaK Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK
EHELCC_06340 EHELCC_06340 100.0 Morganella morganii S2 ybaK Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK
NLDBIP_06660 NLDBIP_06660 100.0 Morganella morganii S4 ybaK Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK
LHKJJB_03540 LHKJJB_03540 100.0 Morganella morganii S3 ybaK Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK
F4V73_RS16210 F4V73_RS16210 96.9 Morganella psychrotolerans ybaK Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK
PMI_RS10725 PMI_RS10725 76.1 Proteus mirabilis HI4320 ybaK Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK

Distribution of the homologs in the orthogroup group_1786

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1786

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AAR4 3.37e-85 249 77 0 159 3 ybaK Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK Shigella flexneri
P0AAR3 3.37e-85 249 77 0 159 1 ybaK Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK Escherichia coli (strain K12)
P37174 6.79e-82 241 75 0 159 3 ybaK Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P45202 9.55e-63 192 61 0 155 1 ybaK Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O31650 5.47e-32 114 45 4 156 3 yjdI Putative Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YjdI Bacillus subtilis (strain 168)
P36922 1.56e-30 111 35 2 158 3 EF_1730 Putative Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase EbsC Enterococcus faecalis (strain ATCC 700802 / V583)
P71000 1.21e-06 48 26 3 143 4 ywhH Uncharacterized protein YwhH Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_07015
Feature type CDS
Gene ybaK
Product Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK
Location 221611 - 222090 (strand: 1)
Length 480 (nucleotides) / 159 (amino acids)

Contig

Accession ZDB_683
Length 224720 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1786
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04073 Aminoacyl-tRNA editing domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2606 Translation, ribosomal structure and biogenesis (J) J Cys-tRNA(Pro) deacylase, prolyl-tRNA editing enzyme YbaK/EbsC

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03976 Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase [EC:3.1.1.-] - -

Protein Sequence

MTPAVKLLEKNRISFTLHPYEHDPNDHNFGDEAVRKLNLDARQVYKTLLVALNGDNKHLAVAVTPVSEQLDLKAVAKALGVKKAEMADPVNAQKVTGYLVGGISPLGQKKRLPTLIDEGAQEFATIFVSGGKRGLDIELAPQDLAKVLDGKFAPVAKRD

Flanking regions ( +/- flanking 50bp)

CTGGCAGGCCTTGTGACACTGCCGTCTGAATTATCTGCAAGGAAAGACCTATGACACCGGCTGTAAAACTTCTGGAAAAAAACCGGATTTCATTCACCCTCCATCCGTATGAACATGATCCGAATGATCATAATTTCGGTGATGAAGCGGTCCGCAAACTCAATCTCGATGCCCGTCAGGTATACAAAACCCTGCTGGTGGCGCTTAACGGTGATAATAAACATCTCGCCGTGGCAGTCACCCCGGTATCAGAACAGCTTGATTTAAAAGCGGTAGCCAAAGCCCTTGGTGTGAAGAAAGCGGAAATGGCTGACCCGGTGAATGCACAGAAAGTCACCGGCTATCTGGTGGGCGGGATCAGCCCGCTGGGACAGAAAAAACGTCTGCCGACCCTGATTGATGAGGGCGCACAGGAATTTGCCACTATTTTTGTTTCCGGCGGCAAACGCGGCCTGGATATCGAACTGGCACCGCAGGATCTGGCAAAAGTGCTGGACGGGAAATTTGCCCCGGTGGCGAAACGGGACTGATACACAGAAAAAAGCACTTCCCGGGGGAAGTGCTTTTTAGCTTATTATTA