Homologs in group_1824

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13025 FBDBKF_13025 96.9 Morganella morganii S1 ybaK Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK
EHELCC_06340 EHELCC_06340 96.9 Morganella morganii S2 ybaK Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK
NLDBIP_06660 NLDBIP_06660 96.9 Morganella morganii S4 ybaK Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK
LHKJJB_03540 LHKJJB_03540 96.9 Morganella morganii S3 ybaK Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK
HKOGLL_07015 HKOGLL_07015 96.9 Morganella morganii S5 ybaK Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK
PMI_RS10725 PMI_RS10725 75.5 Proteus mirabilis HI4320 ybaK Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK

Distribution of the homologs in the orthogroup group_1824

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1824

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AAR4 5.34e-84 246 76 0 159 3 ybaK Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK Shigella flexneri
P0AAR3 5.34e-84 246 76 0 159 1 ybaK Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK Escherichia coli (strain K12)
P37174 8.09e-82 241 75 0 159 3 ybaK Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P45202 9.88e-61 187 59 0 155 1 ybaK Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P36922 2.34e-32 115 36 2 158 3 EF_1730 Putative Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase EbsC Enterococcus faecalis (strain ATCC 700802 / V583)
O31650 7.31e-31 112 44 4 156 3 yjdI Putative Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YjdI Bacillus subtilis (strain 168)
P71000 3.27e-06 47 26 3 142 4 ywhH Uncharacterized protein YwhH Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS16210
Feature type CDS
Gene ybaK
Product Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK
Location 51608 - 52087 (strand: 1)
Length 480 (nucleotides) / 159 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000006
Length 212134 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1824
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04073 Aminoacyl-tRNA editing domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2606 Translation, ribosomal structure and biogenesis (J) J Cys-tRNA(Pro) deacylase, prolyl-tRNA editing enzyme YbaK/EbsC

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03976 Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase [EC:3.1.1.-] - -

Protein Sequence

MTPAVKLLEKNRIAFTLHPYEHDPNDHNFGDEAVRKLNLDAGQVYKTLLVALNGDNKHLAVAVTPVSEQLDLKAVAKALGAKKAEMADPVNAQKVTGYLLGGISPLGQKKRLPTLIDEGAQEFATIFVSGGKRGLDIELAPQDLANVLDGKFAPVAKRD

Flanking regions ( +/- flanking 50bp)

ACTGGCAGACCTTGTGACTCTGCCGTCTGAATTATCAGCAAGGAAATACTATGACACCGGCTGTAAAACTCCTGGAAAAAAACCGGATTGCATTTACGCTGCATCCCTATGAGCACGATCCGAATGACCATAACTTCGGTGATGAAGCGGTCCGCAAACTCAATCTTGATGCCGGTCAGGTATATAAAACCCTGCTGGTGGCACTGAACGGGGATAATAAACATCTCGCCGTCGCTGTCACGCCGGTATCAGAACAGCTTGATTTAAAAGCGGTTGCCAAAGCATTGGGGGCGAAAAAAGCTGAAATGGCAGATCCGGTAAATGCCCAGAAAGTGACCGGTTATCTGCTCGGCGGAATAAGCCCGCTGGGACAGAAAAAACGCCTGCCGACCCTGATTGATGAAGGCGCTCAGGAGTTTGCCACTATTTTTGTGTCCGGCGGCAAGCGCGGTCTGGATATTGAACTGGCCCCGCAGGATCTGGCAAACGTGCTGGACGGAAAGTTTGCGCCGGTGGCAAAGCGGGACTGATACTAAATACAATACCGGGAATATCTCCGGTATTGTATTGTATCTGAAAT